Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 413130..413763 | Replicon | chromosome |
Accession | NZ_CP024163 | ||
Organism | Vibrio cholerae strain E7946 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | CSW01_RS16660 | Protein ID | WP_000843587.1 |
Coordinates | 413130..413462 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CSW01_RS16665 | Protein ID | WP_000071008.1 |
Coordinates | 413449..413763 (+) | Length | 105 a.a. |
Genomic Context
Location: 408571..408774 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 409055..409228 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 409588..409857 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 410175..410346 (172 bp)
Type: Others
Protein ID: Protein_430
Type: Others
Protein ID: Protein_430
Location: 410555..410941 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 411143..411385 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 411556..411933 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 411990..412104 (115 bp)
Type: Others
Protein ID: Protein_434
Type: Others
Protein ID: Protein_434
Location: 412053..412334 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 412500..412613 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 412562..412789 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 413130..413462 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 413449..413763 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 413900..414334 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 414502..414657 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 415830..416136 (307 bp)
Type: Others
Protein ID: Protein_443
Type: Others
Protein ID: Protein_443
Location: 416273..416965 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 416965..417366 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 417336..417479 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 417554..417967 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 418181..418432 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 418422..418709 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 414782..415762 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSW01_RS19990 | 408571..408774 | + | 204 | WP_001911745.1 | hypothetical protein | - |
CSW01_RS19845 | 409055..409228 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
CSW01_RS16590 | 409588..409857 | + | 270 | WP_001198131.1 | hypothetical protein | - |
CSW01_RS16605 | 410175..410346 | + | 172 | Protein_430 | DUF645 family protein | - |
CSW01_RS16610 | 410555..410941 | + | 387 | WP_000703163.1 | VOC family protein | - |
CSW01_RS16615 | 411143..411385 | + | 243 | WP_000107461.1 | hypothetical protein | - |
CSW01_RS16620 | 411556..411933 | + | 378 | WP_000411109.1 | hypothetical protein | - |
CSW01_RS19995 | 411990..412104 | + | 115 | Protein_434 | acetyltransferase | - |
CSW01_RS16625 | 412053..412334 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
CSW01_RS16640 | 412500..412613 | + | 114 | WP_001889158.1 | hypothetical protein | - |
CSW01_RS16645 | 412562..412789 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
CSW01_RS16660 | 413130..413462 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CSW01_RS16665 | 413449..413763 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
CSW01_RS16675 | 413900..414334 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
CSW01_RS19850 | 414502..414657 | + | 156 | WP_000751734.1 | hypothetical protein | - |
CSW01_RS16680 | 414782..415762 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
CSW01_RS16685 | 415830..416136 | + | 307 | Protein_443 | CatB-related O-acetyltransferase | - |
CSW01_RS16690 | 416273..416965 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
CSW01_RS16695 | 416965..417366 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
CSW01_RS16700 | 417336..417479 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
CSW01_RS16705 | 417554..417967 | + | 414 | WP_000049417.1 | VOC family protein | - |
CSW01_RS16710 | 418181..418432 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
CSW01_RS16715 | 418422..418709 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304226..433944 | 129718 | |
inside | Integron | - | - | 309306..433568 | 124262 | ||
flank | IS/Tn | - | - | 414782..415762 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T87025 WP_000843587.1 NZ_CP024163:413130-413462 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T87025 NZ_CP024163:413130-413462 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT87025 WP_000071008.1 NZ_CP024163:413449-413763 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT87025 NZ_CP024163:413449-413763 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA