Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafN(antitoxin) |
Location | 388065..388702 | Replicon | chromosome |
Accession | NZ_CP047296 | ||
Organism | Vibrio cholerae C6706 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | GTF72_RS15750 | Protein ID | WP_000869997.1 |
Coordinates | 388343..388702 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D0IIK3 |
Locus tag | GTF72_RS15745 | Protein ID | WP_000086649.1 |
Coordinates | 388065..388346 (+) | Length | 94 a.a. |
Genomic Context
Location: 383187..383546 (360 bp)
Type: Others
Protein ID: WP_001071514.1
Type: Others
Protein ID: WP_001071514.1
Location: 383729..384052 (324 bp)
Type: Others
Protein ID: WP_001889156.1
Type: Others
Protein ID: WP_001889156.1
Location: 384333..384869 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 385630..385812 (183 bp)
Type: Others
Protein ID: WP_000947517.1
Type: Others
Protein ID: WP_000947517.1
Location: 385931..386716 (786 bp)
Type: Others
Protein ID: WP_001176447.1
Type: Others
Protein ID: WP_001176447.1
Location: 386818..387180 (363 bp)
Type: Others
Protein ID: WP_170831679.1
Type: Others
Protein ID: WP_170831679.1
Location: 387426..387851 (426 bp)
Type: Others
Protein ID: WP_000735184.1
Type: Others
Protein ID: WP_000735184.1
Location: 388065..388346 (282 bp)
Type: Antitoxin
Protein ID: WP_000086649.1
Type: Antitoxin
Protein ID: WP_000086649.1
Location: 388343..388702 (360 bp)
Type: Toxin
Protein ID: WP_000869997.1
Type: Toxin
Protein ID: WP_000869997.1
Location: 388807..389130 (324 bp)
Type: Others
Protein ID: WP_001999495.1
Type: Others
Protein ID: WP_001999495.1
Location: 389416..389811 (396 bp)
Type: Others
Protein ID: WP_000870868.1
Type: Others
Protein ID: WP_000870868.1
Location: 389878..389992 (115 bp)
Type: Others
Protein ID: Protein_401
Type: Others
Protein ID: Protein_401
Location: 390001..390222 (222 bp)
Type: Others
Protein ID: WP_043987927.1
Type: Others
Protein ID: WP_043987927.1
Location: 390586..391011 (426 bp)
Type: Others
Protein ID: WP_000415748.1
Type: Others
Protein ID: WP_000415748.1
Location: 391337..391570 (234 bp)
Type: Others
Protein ID: WP_001999499.1
Type: Others
Protein ID: WP_001999499.1
Location: 391759..392154 (396 bp)
Type: Others
Protein ID: WP_001889207.1
Type: Others
Protein ID: WP_001889207.1
Location: 392373..392762 (390 bp)
Type: Others
Protein ID: WP_000491261.1
Type: Others
Protein ID: WP_000491261.1
Location: 390198..390356 (159 bp)
Type: Others
Protein ID: WP_001909351.1
Type: Others
Protein ID: WP_001909351.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF72_RS15710 | 383187..383546 | + | 360 | WP_001071514.1 | VOC family protein | - |
GTF72_RS15715 | 383729..384052 | + | 324 | WP_001889156.1 | DUF3709 domain-containing protein | - |
GTF72_RS15720 | 384333..384869 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
GTF72_RS15725 | 385630..385812 | + | 183 | WP_000947517.1 | DUF645 family protein | - |
GTF72_RS15730 | 385931..386716 | + | 786 | WP_001176447.1 | hypothetical protein | - |
GTF72_RS15735 | 386818..387180 | + | 363 | WP_170831679.1 | DUF4144 domain-containing protein | - |
GTF72_RS15740 | 387426..387851 | + | 426 | WP_000735184.1 | hypothetical protein | - |
GTF72_RS15745 | 388065..388346 | + | 282 | WP_000086649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GTF72_RS15750 | 388343..388702 | + | 360 | WP_000869997.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF72_RS15755 | 388807..389130 | + | 324 | WP_001999495.1 | DUF3709 domain-containing protein | - |
GTF72_RS15760 | 389416..389811 | + | 396 | WP_000870868.1 | DUF3465 domain-containing protein | - |
GTF72_RS15765 | 389878..389992 | + | 115 | Protein_401 | acetyltransferase | - |
GTF72_RS15770 | 390001..390222 | + | 222 | WP_043987927.1 | DUF1289 domain-containing protein | - |
GTF72_RS15775 | 390198..390356 | - | 159 | WP_001909351.1 | DUF1196 family protein | - |
GTF72_RS15780 | 390586..391011 | + | 426 | WP_000415748.1 | hypothetical protein | - |
GTF72_RS15785 | 391337..391570 | + | 234 | WP_001999499.1 | DUF3709 domain-containing protein | - |
GTF72_RS15790 | 391759..392154 | + | 396 | WP_001889207.1 | DUF4144 domain-containing protein | - |
GTF72_RS15795 | 392373..392762 | + | 390 | WP_000491261.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306905..436165 | 129260 | |
inside | Integron | - | - | 311985..435789 | 123804 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13608.84 Da Isoelectric Point: 8.1459
>T145811 WP_000869997.1 NZ_CP047296:388343-388702 [Vibrio cholerae C6706]
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTLRQEQTVNPPHNKRLKRDCQRVAFPVPLSRGGCSCCV
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTLRQEQTVNPPHNKRLKRDCQRVAFPVPLSRGGCSCCV
Download Length: 360 bp
>T145811 NZ_CP062700:2280502-2280605 [Escherichia coli O157:H7]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 94 a.a. Molecular weight: 10361.93 Da Isoelectric Point: 5.1548
>AT145811 WP_000086649.1 NZ_CP047296:388065-388346 [Vibrio cholerae C6706]
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK
Download Length: 282 bp
>AT145811 NZ_CP062700:c2280643-2280372 [Escherichia coli O157:H7]
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UIW4 |