Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DhiAT/- |
Location | 383262..384046 | Replicon | chromosome |
Accession | NZ_LT992489 | ||
Organism | Vibrio cholerae strain 4295STDY6534232 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | DG176_RS16065 | Protein ID | WP_001114075.1 |
Coordinates | 383777..384046 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | dhiA | Uniprot ID | Q9KM84 |
Locus tag | DG176_RS16060 | Protein ID | WP_000921691.1 |
Coordinates | 383262..383783 (-) | Length | 174 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG176_RS16020 | 380188..380601 | - | 414 | WP_000049420.1 | VOC family protein | - |
DG176_RS16030 | 380785..381300 | - | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
DG176_RS16035 | 381494..381778 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
DG176_RS16040 | 381775..382053 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
DG176_RS16045 | 382192..382587 | - | 396 | WP_001000867.1 | hypothetical protein | - |
DG176_RS16055 | 382838..382963 | - | 126 | WP_001905700.1 | DUF645 family protein | - |
DG176_RS16060 | 383262..383783 | - | 522 | WP_000921691.1 | DUF2442 domain-containing protein | Antitoxin |
DG176_RS16065 | 383777..384046 | - | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
DG176_RS16070 | 384077..384181 | - | 105 | WP_099607150.1 | acetyltransferase | - |
DG176_RS16075 | 384238..384837 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
DG176_RS16080 | 384987..385859 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
DG176_RS16085 | 386034..386252 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
DG176_RS16090 | 386316..386753 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
DG176_RS16095 | 386872..387081 | - | 210 | Protein_329 | GNAT family N-acetyltransferase | - |
DG176_RS16100 | 387217..387606 | - | 390 | WP_001081302.1 | hypothetical protein | - |
DG176_RS16105 | 387763..388680 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 379325..476297 | 96972 | |
flank | IS/Tn | - | - | 386316..386753 | 437 | ||
inside | Integron | catB9 | - | 379701..469509 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T294369 WP_001114075.1 NZ_LT992489:c384046-383777 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
Antitoxin
Download Length: 174 a.a. Molecular weight: 19409.01 Da Isoelectric Point: 6.7342
>AT294369 WP_000921691.1 NZ_LT992489:c383783-383262 [Vibrio cholerae]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
Download Length: 522 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM84 |