Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 415351..415984 | Replicon | chromosome |
Accession | NZ_CP047296 | ||
Organism | Vibrio cholerae C6706 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | GTF72_RS15990 | Protein ID | WP_000843587.1 |
Coordinates | 415351..415683 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | GTF72_RS15995 | Protein ID | WP_000071008.1 |
Coordinates | 415670..415984 (+) | Length | 105 a.a. |
Genomic Context
Location: 410792..410995 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 411276..411449 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 411809..412078 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 412389..412475 (87 bp)
Type: Others
Protein ID: WP_134820423.1
Type: Others
Protein ID: WP_134820423.1
Location: 412475..412567 (93 bp)
Type: Others
Protein ID: Protein_437
Type: Others
Protein ID: Protein_437
Location: 412776..413162 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 413364..413606 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 413777..414154 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 414334..414555 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 414721..414834 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 414783..415010 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 415351..415683 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 415670..415984 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 416121..416555 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 416723..416878 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 418051..418323 (273 bp)
Type: Others
Protein ID: Protein_451
Type: Others
Protein ID: Protein_451
Location: 418494..419186 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 419186..419587 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 419557..419700 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 419775..420188 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 420402..420653 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 420643..420930 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 414531..414689 (159 bp)
Type: Others
Protein ID: WP_001894455.1
Type: Others
Protein ID: WP_001894455.1
Location: 415040..415198 (159 bp)
Type: Others
Protein ID: WP_001882309.1
Type: Others
Protein ID: WP_001882309.1
Location: 417003..417983 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF72_RS15925 | 410792..410995 | + | 204 | WP_001911745.1 | hypothetical protein | - |
GTF72_RS15930 | 411276..411449 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
GTF72_RS15935 | 411809..412078 | + | 270 | WP_001198131.1 | hypothetical protein | - |
GTF72_RS15940 | 412389..412475 | + | 87 | WP_134820423.1 | DUF645 family protein | - |
GTF72_RS15945 | 412475..412567 | + | 93 | Protein_437 | DUF645 family protein | - |
GTF72_RS15950 | 412776..413162 | + | 387 | WP_000703163.1 | VOC family protein | - |
GTF72_RS15955 | 413364..413606 | + | 243 | WP_000107461.1 | hypothetical protein | - |
GTF72_RS15960 | 413777..414154 | + | 378 | WP_000411109.1 | hypothetical protein | - |
GTF72_RS15965 | 414334..414555 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
GTF72_RS15970 | 414531..414689 | - | 159 | WP_001894455.1 | DUF1196 family protein | - |
GTF72_RS15975 | 414721..414834 | + | 114 | WP_001889158.1 | hypothetical protein | - |
GTF72_RS15980 | 414783..415010 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GTF72_RS15985 | 415040..415198 | - | 159 | WP_001882309.1 | DUF1196 family protein | - |
GTF72_RS15990 | 415351..415683 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF72_RS15995 | 415670..415984 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
GTF72_RS16000 | 416121..416555 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16005 | 416723..416878 | + | 156 | WP_000751734.1 | hypothetical protein | - |
GTF72_RS16010 | 417003..417983 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GTF72_RS16015 | 418051..418323 | + | 273 | Protein_451 | CatB-related O-acetyltransferase | - |
GTF72_RS16020 | 418494..419186 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16025 | 419186..419587 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GTF72_RS16030 | 419557..419700 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GTF72_RS16035 | 419775..420188 | + | 414 | WP_000049417.1 | VOC family protein | - |
GTF72_RS16040 | 420402..420653 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF72_RS16045 | 420643..420930 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306905..436165 | 129260 | |
inside | Integron | - | - | 311985..435789 | 123804 | ||
flank | IS/Tn | - | - | 417003..417983 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T145813 WP_000843587.1 NZ_CP047296:415351-415683 [Vibrio cholerae C6706]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T145813 NZ_CP062700:2765581-2765757 [Escherichia coli O157:H7]
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATGGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATGGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT145813 WP_000071008.1 NZ_CP047296:415670-415984 [Vibrio cholerae C6706]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT145813 NZ_CP062700:2765803-2766219 [Escherichia coli O157:H7]
ATGCGTTATCCCGTCACTCTTACACCCGCGCCGGAAGGCGGTTATATGGTTTCTTTTGTGGATATCCCTGAAGCGTTGAC
GCAGGGCGAAACTGTCGCTGAAGCGATGGAAGCGGCAAAAGATGCTTTACTGACCGCATTTGATTTTTATTTTGAAGATA
ACGAGCTTATCCCTTTACCTTCGCCATTAAATAGTCATGATCACTTTATTGAAGTACCTTTGAGCGTCGCCTCTAAGGTA
TTGCTGTTAAATGCTTTTTTACAGTCAGAAATCACTCAGCAAGAGTTAGCCAGGCGAATTGGCAAACCTAAACAAGAGAT
TACTCGCCTATTTAACTTGCATCATGCGACAAAAATCGACGCCGTCCAGCTCGCGGCAAAGGCGCTTGGCAAAGAGTTAT
CGCTGGTGATGGTTTAA
ATGCGTTATCCCGTCACTCTTACACCCGCGCCGGAAGGCGGTTATATGGTTTCTTTTGTGGATATCCCTGAAGCGTTGAC
GCAGGGCGAAACTGTCGCTGAAGCGATGGAAGCGGCAAAAGATGCTTTACTGACCGCATTTGATTTTTATTTTGAAGATA
ACGAGCTTATCCCTTTACCTTCGCCATTAAATAGTCATGATCACTTTATTGAAGTACCTTTGAGCGTCGCCTCTAAGGTA
TTGCTGTTAAATGCTTTTTTACAGTCAGAAATCACTCAGCAAGAGTTAGCCAGGCGAATTGGCAAACCTAAACAAGAGAT
TACTCGCCTATTTAACTTGCATCATGCGACAAAAATCGACGCCGTCCAGCTCGCGGCAAAGGCGCTTGGCAAAGAGTTAT
CGCTGGTGATGGTTTAA