Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 393138..393716 | Replicon | chromosome |
Accession | NZ_CP013306 | ||
Organism | Vibrio cholerae strain CRC1106 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | ASZ81_RS16420 | Protein ID | WP_001180243.1 |
Coordinates | 393138..393455 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | ASZ81_RS16425 | Protein ID | WP_000557292.1 |
Coordinates | 393474..393716 (-) | Length | 81 a.a. |
Genomic Context
Location: 388179..388319 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 388329..388724 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 389027..389208 (182 bp)
Type: Others
Protein ID: Protein_397
Type: Others
Protein ID: Protein_397
Location: 389385..389780 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 389924..390460 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 390757..390936 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 391132..391557 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 391706..392053 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 392200..392493 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 392849..392944 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 393958..394467 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 394524..395177 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 395487..395705 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 396108..396341 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 396766..396946 (181 bp)
Type: Others
Protein ID: Protein_411
Type: Others
Protein ID: Protein_411
Location: 397213..397500 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 397511..397828 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 397825..397935 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 398112..398237 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 398253..398291 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 393138..393455 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 393474..393716 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ81_RS16365 | 388179..388319 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
ASZ81_RS16370 | 388329..388724 | + | 396 | WP_000046952.1 | hypothetical protein | - |
ASZ81_RS16375 | 389027..389208 | + | 182 | Protein_397 | DUF645 family protein | - |
ASZ81_RS16380 | 389385..389780 | + | 396 | WP_000046953.1 | hypothetical protein | - |
ASZ81_RS16385 | 389924..390460 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ASZ81_RS16390 | 390757..390936 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
ASZ81_RS16395 | 391132..391557 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
ASZ81_RS16400 | 391706..392053 | + | 348 | WP_000933409.1 | hypothetical protein | - |
ASZ81_RS20565 | 392200..392493 | + | 294 | WP_125460920.1 | hypothetical protein | - |
ASZ81_RS20935 | 392849..392944 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
ASZ81_RS16420 | 393138..393455 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ81_RS16425 | 393474..393716 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ81_RS16430 | 393958..394467 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
ASZ81_RS16435 | 394524..395177 | + | 654 | WP_000226874.1 | hypothetical protein | - |
ASZ81_RS16440 | 395487..395705 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
ASZ81_RS16450 | 396108..396341 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
ASZ81_RS16455 | 396766..396946 | + | 181 | Protein_411 | DUF645 family protein | - |
ASZ81_RS16460 | 397213..397500 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ81_RS16465 | 397511..397828 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
ASZ81_RS20940 | 397825..397935 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
ASZ81_RS20945 | 398112..398237 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
ASZ81_RS20950 | 398253..398291 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304741..463550 | 158809 | |
inside | Integron | - | - | 309821..463174 | 153353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T58269 WP_001180243.1 NZ_CP013306:c393455-393138 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T58269 NZ_CP013306:c393455-393138 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT58269 WP_000557292.1 NZ_CP013306:c393716-393474 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT58269 NZ_CP013306:c393716-393474 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |