Detailed information of TA system TA294348

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RelE-RelB
• Location: 899694..900253
• Replicon: chromosome
• Accession: NZ_LT992487
• Organism: Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)

• Gene name: relE
• Uniprot ID: Q9K2M8
• Locus tag: DG247_RS18345
• Protein ID: WP_000578476.1
• Coordinates: 899975..900253 (+)
• Length: 93 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: Q9L991
• Locus tag: DG247_RS18340
• Protein ID: WP_000381183.1
• Coordinates: 899694..899978 (+)
• Length: 95 a.a.

Genomic Context

Location: 899694..899978 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1

Location: 899975..900253 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1

Location: 898388..898801 (414 bp)
Type: Others
Protein ID: WP_000049420.1

Location: 898985..899500 (516 bp)
Type: Others
Protein ID: WP_000343779.1

Location: 900392..900787 (396 bp)
Type: Others
Protein ID: WP_001000867.1

Location: 901038..901163 (126 bp)
Type: Others
Protein ID: WP_001905700.1

Location: 901462..901983 (522 bp)
Type: Others
Protein ID: WP_000921691.1

Location: 901977..902246 (270 bp)
Type: Others
Protein ID: WP_001114075.1

Location: 902277..902381 (105 bp)
Type: Others
Protein ID: WP_099607150.1

Location: 902438..903037 (600 bp)
Type: Others
Protein ID: WP_001891245.1

Location: 903187..904059 (873 bp)
Type: Others
Protein ID: WP_000254716.1

Location: 904234..904452 (219 bp)
Type: Others
Protein ID: WP_071908318.1

Location: 904516..904953 (438 bp)
Type: Others
Protein ID: WP_000503169.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DG247_RS18325	898388..898801	-	414	WP_000049420.1	VOC family protein	-
DG247_RS18335	898985..899500	-	516	WP_000343779.1	GNAT family N-acetyltransferase	-
DG247_RS18340	899694..899978	+	285	WP_000381183.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	Antitoxin
DG247_RS18345	899975..900253	+	279	WP_000578476.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	Toxin
DG247_RS18350	900392..900787	-	396	WP_001000867.1	hypothetical protein	-
DG247_RS18360	901038..901163	-	126	WP_001905700.1	DUF645 family protein	-
DG247_RS18365	901462..901983	-	522	WP_000921691.1	DUF2442 domain-containing protein	-
DG247_RS18370	901977..902246	-	270	WP_001114075.1	DUF4160 domain-containing protein	-
DG247_RS18375	902277..902381	-	105	WP_099607150.1	acetyltransferase	-
DG247_RS18380	902438..903037	-	600	WP_001891245.1	glutathione S-transferase N-terminal domain-containing protein	-
DG247_RS18385	903187..904059	-	873	WP_000254716.1	DUF3800 domain-containing protein	-
DG247_RS18390	904234..904452	-	219	WP_071908318.1	GNAT family N-acetyltransferase	-
DG247_RS18395	904516..904953	-	438	WP_000503169.1	IS200/IS605-like element IS1004 family transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	897525..994497	96972
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0.005	inside	Integron	catB9	-	897901..987709	89808
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA000179, TA000177, TA000178, TA010035 428335..428772 0	flank	IS/Tn	-	-	904516..904953	437

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (2-89)

Antitoxin

• RelB antitoxin/Antitoxin DinJ (5-70)

Sequences

Toxin

Protein

• Length: 93 a.a.
• Molecular weight: 10819.59 Da
• Isoelectric Point: 5.1651

>T294348 WP_000578476.1 NZ_LT992487:899975-900253 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Nucleotide

• Length: 279 bp

Antitoxin

Protein

• Length: 95 a.a.
• Molecular weight: 10901.25 Da
• Isoelectric Point: 8.0775

>AT294348 WP_000381183.1 NZ_LT992487:899694-899978 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Nucleotide

• Length: 285 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: Q9K2M8

Antitoxin

Loading, please wait

• AlphaFold DB: A0A067BL33