Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 258050..258628 | Replicon | chromosome |
Accession | NZ_AP024554 | ||
Organism | Vibrio cholerae strain IDH-03329 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | K6J80_RS15180 | Protein ID | WP_001180243.1 |
Coordinates | 258311..258628 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | K6J80_RS15175 | Protein ID | WP_000557292.1 |
Coordinates | 258050..258292 (+) | Length | 81 a.a. |
Genomic Context
Location: 258050..258292 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Location: 258311..258628 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 253450..253566 (117 bp)
Type: Others
Protein ID: WP_001889170.1
Type: Others
Protein ID: WP_001889170.1
Location: 253529..253654 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 253682..253792 (111 bp)
Type: Others
Protein ID: Protein_262
Type: Others
Protein ID: Protein_262
Location: 253831..253941 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 253938..254255 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 254266..254553 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 254594..254707 (114 bp)
Type: Others
Protein ID: WP_001894955.1
Type: Others
Protein ID: WP_001894955.1
Location: 254820..255000 (181 bp)
Type: Others
Protein ID: Protein_267
Type: Others
Protein ID: Protein_267
Location: 255425..255658 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 255679..255872 (194 bp)
Type: Others
Protein ID: Protein_269
Type: Others
Protein ID: Protein_269
Location: 256061..256279 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 256291..256500 (210 bp)
Type: Others
Protein ID: WP_001900246.1
Type: Others
Protein ID: WP_001900246.1
Location: 256589..257242 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 257299..257808 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 258822..258974 (153 bp)
Type: Others
Protein ID: Protein_276
Type: Others
Protein ID: Protein_276
Location: 259035..259210 (176 bp)
Type: Others
Protein ID: Protein_277
Type: Others
Protein ID: Protein_277
Location: 259273..259566 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 259713..260060 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 260209..260634 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 260793..260903 (111 bp)
Type: Others
Protein ID: WP_223804330.1
Type: Others
Protein ID: WP_223804330.1
Location: 260893..260955 (63 bp)
Type: Others
Protein ID: Protein_282
Type: Others
Protein ID: Protein_282
Location: 261306..261842 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 261986..262381 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 262558..262677 (120 bp)
Type: Others
Protein ID: WP_001900954.1
Type: Others
Protein ID: WP_001900954.1
Location: 262800..262943 (144 bp)
Type: Others
Protein ID: Protein_286
Type: Others
Protein ID: Protein_286
Location: 263042..263437 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J80_RS18990 | 253450..253566 | - | 117 | WP_001889170.1 | hypothetical protein | - |
K6J80_RS15135 | 253529..253654 | - | 126 | WP_001944767.1 | DUF645 family protein | - |
K6J80_RS18995 | 253682..253792 | - | 111 | Protein_262 | acetyltransferase | - |
K6J80_RS19000 | 253831..253941 | - | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
K6J80_RS15140 | 253938..254255 | - | 318 | WP_001232701.1 | HigA family addiction module antitoxin | - |
K6J80_RS15145 | 254266..254553 | - | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
K6J80_RS19005 | 254594..254707 | - | 114 | WP_001894955.1 | hypothetical protein | - |
K6J80_RS15150 | 254820..255000 | - | 181 | Protein_267 | DUF645 family protein | - |
K6J80_RS15155 | 255425..255658 | - | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
K6J80_RS19010 | 255679..255872 | - | 194 | Protein_269 | hypothetical protein | - |
K6J80_RS15160 | 256061..256279 | - | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
K6J80_RS19015 | 256291..256500 | - | 210 | WP_001900246.1 | DUF3709 domain-containing protein | - |
K6J80_RS15165 | 256589..257242 | - | 654 | WP_000226874.1 | hypothetical protein | - |
K6J80_RS15170 | 257299..257808 | - | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
K6J80_RS15175 | 258050..258292 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
K6J80_RS15180 | 258311..258628 | + | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J80_RS19020 | 258822..258974 | - | 153 | Protein_276 | DUF645 family protein | - |
K6J80_RS19025 | 259035..259210 | - | 176 | Protein_277 | acetyltransferase | - |
K6J80_RS15190 | 259273..259566 | - | 294 | WP_125460920.1 | hypothetical protein | - |
K6J80_RS15195 | 259713..260060 | - | 348 | WP_000933409.1 | hypothetical protein | - |
K6J80_RS15200 | 260209..260634 | - | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
K6J80_RS19030 | 260793..260903 | - | 111 | WP_223804330.1 | Tfp pilus assembly protein | - |
K6J80_RS19035 | 260893..260955 | - | 63 | Protein_282 | DUF645 family protein | - |
K6J80_RS15210 | 261306..261842 | - | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
K6J80_RS15215 | 261986..262381 | - | 396 | WP_000046953.1 | DUF6404 family protein | - |
K6J80_RS15220 | 262558..262677 | - | 120 | WP_001900954.1 | DUF645 family protein | - |
K6J80_RS19040 | 262800..262943 | - | 144 | Protein_286 | acetyltransferase | - |
K6J80_RS15225 | 263042..263437 | - | 396 | WP_000046952.1 | DUF6404 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 213119..319686 | 106567 | |
inside | Integron | - | - | 213119..312856 | 99737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T38678 WP_001180243.1 NZ_AP024554:258311-258628 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T38678 NZ_AP024554:258311-258628 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT38678 WP_000557292.1 NZ_AP024554:258050-258292 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT38678 NZ_AP024554:258050-258292 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |