294417

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 279056..279822 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag DG169_RS16115 Protein ID WP_000982260.1
Coordinates 279056..279553 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag DG169_RS16120 Protein ID WP_000246253.1
Coordinates 279550..279822 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS16065 274918..275224 + 307 Protein_305 CatB-related O-acetyltransferase -
DG169_RS16070 275361..276053 + 693 WP_001047169.1 GNAT family N-acetyltransferase -
DG169_RS16075 276053..276454 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
DG169_RS16080 276424..276567 + 144 WP_071908341.1 DUF3265 domain-containing protein -
DG169_RS16085 276642..277055 + 414 WP_000049417.1 VOC family protein -
DG169_RS16090 277269..277520 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG169_RS16095 277510..277797 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG169_RS16100 277925..278380 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
DG169_RS16105 278702..278854 + 153 WP_001884520.1 DUF645 family protein -
DG169_RS16115 279056..279553 - 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
DG169_RS16120 279550..279822 - 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
DG169_RS16125 280053..280721 + 669 WP_000043871.1 hypothetical protein -
DG169_RS16130 280873..281160 + 288 WP_000426470.1 hypothetical protein -
DG169_RS16135 281301..281672 + 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG169_RS16140 281739..282164 + 426 WP_001882332.1 DUF1778 domain-containing protein -
DG169_RS16145 282161..282694 + 534 WP_000118351.1 GNAT family N-acetyltransferase -
DG169_RS16155 282896..283153 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG169_RS16160 283141..283443 + 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG169_RS16170 283677..284594 + 918 WP_000186333.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808
flank IS/Tn - - 273870..274850 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T294417 WP_000982260.1 NZ_LT992493:c279553-279056 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT294417 WP_000246253.1 NZ_LT992493:c279822-279550 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References