Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 326772..327538 | Replicon | chromosome |
Accession | NZ_CP072850 | ||
Organism | Vibrio cholerae MO10 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | KAF59_RS15270 | Protein ID | WP_000982260.1 |
Coordinates | 326772..327269 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9K2J6 |
Locus tag | KAF59_RS15275 | Protein ID | WP_000246253.1 |
Coordinates | 327266..327538 (-) | Length | 91 a.a. |
Genomic Context
Location: 322214..322918 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Location: 323076..323414 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 324390..324776 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 324833..324946 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 324955..325176 (222 bp)
Type: Others
Protein ID: WP_032467793.1
Type: Others
Protein ID: WP_032467793.1
Location: 325434..325970 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 326161..326622 (462 bp)
Type: Others
Protein ID: WP_001903091.1
Type: Others
Protein ID: WP_001903091.1
Location: 326687..326755 (69 bp)
Type: Others
Protein ID: Protein_286
Type: Others
Protein ID: Protein_286
Location: 327931..328056 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 328306..328752 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 329491..329608 (118 bp)
Type: Others
Protein ID: Protein_293
Type: Others
Protein ID: Protein_293
Location: 329726..330004 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 330364..330462 (99 bp)
Type: Others
Protein ID: WP_223225486.1
Type: Others
Protein ID: WP_223225486.1
Location: 330662..330763 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 330753..331139 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 331334..331585 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 331558..331707 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 331799..332041 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 323568..323885 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 323904..324146 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 326772..327269 (498 bp)
Type: Toxin
Protein ID: WP_000982260.1
Type: Toxin
Protein ID: WP_000982260.1
Location: 327266..327538 (273 bp)
Type: Antitoxin
Protein ID: WP_000246253.1
Type: Antitoxin
Protein ID: WP_000246253.1
Location: 328900..329169 (270 bp)
Type: Others
Protein ID: WP_000277238.1
Type: Others
Protein ID: WP_000277238.1
Location: 329162..329440 (279 bp)
Type: Others
Protein ID: WP_001258569.1
Type: Others
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KAF59_RS15225 (KAF59_15225) | 322214..322918 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
KAF59_RS15230 (KAF59_15230) | 323076..323414 | + | 339 | WP_000713853.1 | hypothetical protein | - |
KAF59_RS15235 (KAF59_15235) | 323568..323885 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KAF59_RS15240 (KAF59_15240) | 323904..324146 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
KAF59_RS15245 (KAF59_15245) | 324390..324776 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
KAF59_RS15250 (KAF59_15250) | 324833..324946 | + | 114 | WP_001900214.1 | hypothetical protein | - |
KAF59_RS15255 (KAF59_15255) | 324955..325176 | + | 222 | WP_032467793.1 | DUF1289 domain-containing protein | - |
KAF59_RS15260 (KAF59_15260) | 325434..325970 | + | 537 | WP_000469482.1 | GNAT family protein | - |
KAF59_RS15265 (KAF59_15265) | 326161..326622 | + | 462 | WP_001903091.1 | lipocalin family protein | - |
KAF59_RS18800 | 326687..326755 | + | 69 | Protein_286 | acetyltransferase | - |
KAF59_RS15270 (KAF59_15270) | 326772..327269 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
KAF59_RS15275 (KAF59_15275) | 327266..327538 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
KAF59_RS15280 (KAF59_15280) | 327931..328056 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
KAF59_RS15290 (KAF59_15290) | 328306..328752 | + | 447 | WP_000006157.1 | hypothetical protein | - |
KAF59_RS15295 (KAF59_15295) | 328900..329169 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | - |
KAF59_RS15300 (KAF59_15300) | 329162..329440 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
KAF59_RS18805 | 329491..329608 | + | 118 | Protein_293 | DUF3265 domain-containing protein | - |
KAF59_RS15305 (KAF59_15305) | 329726..330004 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
KAF59_RS18810 | 330364..330462 | + | 99 | WP_223225486.1 | DUF3709 domain-containing protein | - |
KAF59_RS15315 (KAF59_15315) | 330662..330763 | + | 102 | WP_001921603.1 | hypothetical protein | - |
KAF59_RS15320 (KAF59_15320) | 330753..331139 | + | 387 | WP_000703163.1 | VOC family protein | - |
KAF59_RS15325 (KAF59_15325) | 331334..331585 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
KAF59_RS15330 (KAF59_15330) | 331558..331707 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
KAF59_RS15335 (KAF59_15335) | 331799..332041 | + | 243 | WP_000107461.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306928..402189 | 95261 | |
inside | Integron | catB9 | - | 312008..401813 | 89805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T198999 WP_000982260.1 NZ_CP072850:c327269-326772 [Vibrio cholerae MO10]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
>T198999 NZ_CP097082:c5145045-5144662 [Klebsiella pneumoniae]
ATGACCTCCGGATCTGCGCTTTTTGATACCAATATTCTTATTGATTTATTTAGCGGGCGTCGCGAAGCCAAACAGGCGCT
GGAGGCCTGGCCACCGCAGAATGCGATCAGTCTGATTACCTGGATGGAGGTGATGGTTGGCGCTAAAAAATATCACCAGG
AGCAGCGCACGCGAATGGCGCTGAGCACCTTTAATATCATTAACATCTCACAGGATATTGCAGAGCGAAGCGTTGCGCTG
CGGCAGGAGTATAAGCTTAAGCTGCCGGATGCCATCATTCTGGCGACGGCGCAACTCCATCGTCTGGAACTAATTACGCG
GAATACGAAGGATTTTGCCGGTATTCCTGGCGTAGTCACGCCGTACGAAATCCACCCTGAATAA
ATGACCTCCGGATCTGCGCTTTTTGATACCAATATTCTTATTGATTTATTTAGCGGGCGTCGCGAAGCCAAACAGGCGCT
GGAGGCCTGGCCACCGCAGAATGCGATCAGTCTGATTACCTGGATGGAGGTGATGGTTGGCGCTAAAAAATATCACCAGG
AGCAGCGCACGCGAATGGCGCTGAGCACCTTTAATATCATTAACATCTCACAGGATATTGCAGAGCGAAGCGTTGCGCTG
CGGCAGGAGTATAAGCTTAAGCTGCCGGATGCCATCATTCTGGCGACGGCGCAACTCCATCGTCTGGAACTAATTACGCG
GAATACGAAGGATTTTGCCGGTATTCCTGGCGTAGTCACGCCGTACGAAATCCACCCTGAATAA
Antitoxin
Download Length: 91 a.a. Molecular weight: 9683.22 Da Isoelectric Point: 6.2988
>AT198999 WP_000246253.1 NZ_CP072850:c327538-327266 [Vibrio cholerae MO10]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ
Download Length: 273 bp
>AT198999 NZ_CP097082:c5145287-5145045 [Klebsiella pneumoniae]
ATGATGGCTGAAAGGGATATGGGCAGAATTCTTCTCGATTTATCAGACGATGTCATTCAACGTCTCGATGACCTCAAAGT
GCAGCGTAACATTCCGCGAGCGGAACTGTTACGTGAAGCGGTTGAACAATATCTGGAGAAACAAGATCGAGCTAAAGATA
CCATCTCCAGTGCGCTGGGTCTGTGGCAAGACTGCGAAGAAGACGGCATGGAATATCAACGTCAGCTACGCAAGGAGTGG
TAA
ATGATGGCTGAAAGGGATATGGGCAGAATTCTTCTCGATTTATCAGACGATGTCATTCAACGTCTCGATGACCTCAAAGT
GCAGCGTAACATTCCGCGAGCGGAACTGTTACGTGAAGCGGTTGAACAATATCTGGAGAAACAAGATCGAGCTAAAGATA
CCATCTCCAGTGCGCTGGGTCTGTGGCAAGACTGCGAAGAAGACGGCATGGAATATCAACGTCAGCTACGCAAGGAGTGG
TAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 1Y9B | |
AlphaFold DB | A0A0F2IC79 |