294406

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 214408..214986 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag DG169_RS15385 Protein ID WP_001180243.1
Coordinates 214408..214725 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag DG169_RS15390 Protein ID WP_000557292.1
Coordinates 214744..214986 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS15345 209932..210114 + 183 WP_000923340.1 DUF645 family protein -
DG169_RS15350 210468..210650 + 183 WP_000923153.1 DUF645 family protein -
DG169_RS15360 210845..211522 + 678 WP_000254617.1 HNH endonuclease -
DG169_RS15365 211684..212892 + 1209 WP_000272282.1 deoxyguanosinetriphosphate triphosphohydrolase family protein -
DG169_RS15370 213054..213758 + 705 WP_000087610.1 HNH endonuclease -
DG169_RS15375 213916..214254 + 339 WP_000713853.1 hypothetical protein -
DG169_RS15385 214408..214725 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG169_RS15390 214744..214986 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG169_RS15395 215230..215616 + 387 WP_001015867.1 NUDIX hydrolase -
DG169_RS15400 215673..215786 + 114 WP_001900214.1 hypothetical protein -
DG169_RS15405 215735..216016 + 282 WP_001894429.1 DUF1289 domain-containing protein -
DG169_RS15420 216274..216810 + 537 WP_000469482.1 GNAT family N-acetyltransferase -
DG169_RS15425 216947..217462 + 516 WP_001201509.1 lipocalin family protein -
DG169_RS15430 217612..218109 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG169_RS15435 218106..218378 - 273 WP_000246253.1 DUF1778 domain-containing protein -
DG169_RS15440 218771..218896 + 126 WP_001900195.1 DUF645 family protein -
DG169_RS15445 218912..218950 + 39 WP_106019118.1 hypothetical protein -
DG169_RS15455 219146..219592 + 447 WP_000006157.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T294406 WP_001180243.1 NZ_LT992493:c214725-214408 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT294406 WP_000557292.1 NZ_LT992493:c214986-214744 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References