Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-GNAT |
| Location | 275361..276454 | Replicon | chromosome |
| Accession | NZ_LT992493 | ||
| Organism | Vibrio cholerae strain 4295STDY6534248 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | Q9KMA2 |
| Locus tag | DG169_RS16075 | Protein ID | WP_000351248.1 |
| Coordinates | 276053..276454 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | DG169_RS16070 | Protein ID | WP_001047169.1 |
| Coordinates | 275361..276053 (+) | Length | 231 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG169_RS16005 | 270644..271021 | + | 378 | WP_000411109.1 | hypothetical protein | - |
| DG169_RS19860 | 271078..271192 | + | 115 | Protein_296 | acetyltransferase | - |
| DG169_RS16010 | 271141..271422 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
| DG169_RS16025 | 271588..271701 | + | 114 | WP_001889158.1 | hypothetical protein | - |
| DG169_RS16030 | 271650..271877 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
| DG169_RS16045 | 272218..272550 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG169_RS16050 | 272537..272851 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
| DG169_RS16055 | 272988..273422 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
| DG169_RS19685 | 273590..273745 | + | 156 | WP_000751734.1 | hypothetical protein | - |
| DG169_RS16060 | 273870..274850 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
| DG169_RS16065 | 274918..275224 | + | 307 | Protein_305 | CatB-related O-acetyltransferase | - |
| DG169_RS16070 | 275361..276053 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | Antitoxin |
| DG169_RS16075 | 276053..276454 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| DG169_RS16080 | 276424..276567 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
| DG169_RS16085 | 276642..277055 | + | 414 | WP_000049417.1 | VOC family protein | - |
| DG169_RS16090 | 277269..277520 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| DG169_RS16095 | 277510..277797 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG169_RS16100 | 277925..278380 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16105 | 278702..278854 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
| DG169_RS16115 | 279056..279553 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16120 | 279550..279822 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| DG169_RS16125 | 280053..280721 | + | 669 | WP_000043871.1 | hypothetical protein | - |
| DG169_RS16130 | 280873..281160 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 197768..293032 | 95264 | |
| inside | Integron | catB9 | - | 202848..292656 | 89808 | ||
| flank | IS/Tn | - | - | 273870..274850 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T294415 WP_000351248.1 NZ_LT992493:276053-276454 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
Antitoxin
Download Length: 231 a.a. Molecular weight: 26352.73 Da Isoelectric Point: 8.5633
>AT294415 WP_001047169.1 NZ_LT992493:275361-276053 [Vibrio cholerae]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 693 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|