Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 366990..367605 | Replicon | chromosome |
Accession | NZ_CP025937 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | C1H56_RS16200 | Protein ID | WP_001162670.1 |
Coordinates | 366990..367277 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | C1H56_RS16205 | Protein ID | WP_001232701.1 |
Coordinates | 367288..367605 (+) | Length | 106 a.a. |
Genomic Context
Location: 362626..362721 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 363735..364244 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 364301..364954 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 365264..365482 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 365885..366118 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 366543..366723 (181 bp)
Type: Others
Protein ID: Protein_360
Type: Others
Protein ID: Protein_360
Location: 366990..367277 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1
Type: Toxin
Protein ID: WP_001162670.1
Location: 367288..367605 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1
Type: Antitoxin
Protein ID: WP_001232701.1
Location: 367602..367712 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 367889..368014 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 368030..368068 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 368145..368246 (102 bp)
Type: Others
Protein ID: Protein_366
Type: Others
Protein ID: Protein_366
Location: 368292..369032 (741 bp)
Type: Others
Protein ID: WP_000469836.1
Type: Others
Protein ID: WP_000469836.1
Location: 369237..370067 (831 bp)
Type: Others
Protein ID: WP_000056616.1
Type: Others
Protein ID: WP_000056616.1
Location: 370124..370606 (483 bp)
Type: Others
Protein ID: WP_001895003.1
Type: Others
Protein ID: WP_001895003.1
Location: 371053..371928 (876 bp)
Type: Others
Protein ID: WP_000259044.1
Type: Others
Protein ID: WP_000259044.1
Location: 372058..372513 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 362915..363232 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 363251..363493 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1H56_RS19960 | 362626..362721 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
C1H56_RS16160 | 362915..363232 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
C1H56_RS16165 | 363251..363493 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
C1H56_RS16170 | 363735..364244 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
C1H56_RS16175 | 364301..364954 | + | 654 | WP_000226874.1 | hypothetical protein | - |
C1H56_RS16180 | 365264..365482 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
C1H56_RS16185 | 365885..366118 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
C1H56_RS16190 | 366543..366723 | + | 181 | Protein_360 | DUF645 family protein | - |
C1H56_RS16200 | 366990..367277 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C1H56_RS16205 | 367288..367605 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
C1H56_RS19965 | 367602..367712 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
C1H56_RS16220 | 367889..368014 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
C1H56_RS19855 | 368030..368068 | + | 39 | WP_106019119.1 | hypothetical protein | - |
C1H56_RS19970 | 368145..368246 | + | 102 | Protein_366 | exlusion protein FxsA | - |
C1H56_RS16230 | 368292..369032 | + | 741 | WP_000469836.1 | PhzF family phenazine biosynthesis protein | - |
C1H56_RS16235 | 369237..370067 | + | 831 | WP_000056616.1 | abortive infection family protein | - |
C1H56_RS16240 | 370124..370606 | + | 483 | WP_001895003.1 | hypothetical protein | - |
C1H56_RS16250 | 371053..371928 | + | 876 | WP_000259044.1 | hypothetical protein | - |
C1H56_RS16255 | 372058..372513 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304067..433328 | 129261 | |
inside | Integron | catB9 | - | 309147..432952 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T92509 WP_001162670.1 NZ_CP025937:366990-367277 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T92509 NZ_CP025937:366990-367277 [Vibrio cholerae]
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT92509 WP_001232701.1 NZ_CP025937:367288-367605 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
>AT92509 NZ_CP025937:367288-367605 [Vibrio cholerae]
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F2HI36 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |