Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
| Location | 809220..810019 | Replicon | chromosome |
| Accession | NZ_CP102928 | ||
| Organism | Vibrio cholerae strain N1252 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | Q9KM94 |
| Locus tag | NW313_RS17910 | Protein ID | WP_000118351.1 |
| Coordinates | 809486..810019 (+) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0K9UER4 |
| Locus tag | NW313_RS17905 | Protein ID | WP_000179600.1 |
| Coordinates | 809220..809489 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW313_RS17845 | 804594..804845 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NW313_RS17850 | 804835..805122 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NW313_RS17855 | 805250..805705 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| NW313_RS17860 | 805762..805884 | + | 123 | Protein_795 | acetyltransferase | - |
| NW313_RS17865 | 806055..806179 | + | 125 | Protein_796 | DUF645 family protein | - |
| NW313_RS17870 | 806296..806364 | + | 69 | Protein_797 | acetyltransferase | - |
| NW313_RS17875 | 806381..806878 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| NW313_RS17880 | 806875..807147 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| NW313_RS17885 | 807299..807361 | + | 63 | Protein_800 | acetyltransferase | - |
| NW313_RS17890 | 807378..808046 | + | 669 | WP_000043871.1 | hypothetical protein | - |
| NW313_RS17895 | 808198..808485 | + | 288 | WP_000426470.1 | hypothetical protein | - |
| NW313_RS17900 | 808626..808997 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| NW313_RS17905 | 809220..809489 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | Antitoxin |
| NW313_RS17910 | 809486..810019 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | Toxin |
| NW313_RS17915 | 810029..810139 | + | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
| NW313_RS17920 | 810221..810478 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NW313_RS17925 | 810466..810768 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NW313_RS17930 | 811002..811919 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
| NW313_RS17935 | 812076..812465 | + | 390 | WP_001081302.1 | hypothetical protein | - |
| NW313_RS17940 | 812601..812810 | + | 210 | Protein_811 | GNAT family N-acetyltransferase | - |
| NW313_RS17945 | 812929..813366 | + | 438 | WP_000503164.1 | IS200/IS605-like element IS1004 family transposase | - |
| NW313_RS17950 | 813427..813648 | + | 222 | Protein_813 | GNAT family N-acetyltransferase | - |
| NW313_RS17955 | 813823..814695 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 713852..820357 | 106505 | |
| inside | Integron | catB9 | - | 718932..819981 | 101049 | ||
| flank | IS/Tn | - | - | 812929..813366 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 20171.46 Da Isoelectric Point: 9.1432
>T254478 WP_000118351.1 NZ_CP102928:809486-810019 [Vibrio cholerae]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9KM94 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9UER4 |