Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 415348..415981 | Replicon | chromosome |
Accession | NZ_CP047298 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain C6709 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | GTF73_RS16015 | Protein ID | WP_000843587.1 |
Coordinates | 415348..415680 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | GTF73_RS16020 | Protein ID | WP_000071008.1 |
Coordinates | 415667..415981 (+) | Length | 105 a.a. |
Genomic Context
Location: 410789..410992 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 411273..411446 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 411806..412075 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 412386..412472 (87 bp)
Type: Others
Protein ID: WP_134820423.1
Type: Others
Protein ID: WP_134820423.1
Location: 412472..412564 (93 bp)
Type: Others
Protein ID: Protein_437
Type: Others
Protein ID: Protein_437
Location: 412773..413159 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 413361..413603 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 413774..414151 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 414331..414552 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 414718..414831 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 414780..415007 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 415348..415680 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 415667..415981 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 416118..416552 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 416720..416875 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 418048..418320 (273 bp)
Type: Others
Protein ID: Protein_451
Type: Others
Protein ID: Protein_451
Location: 418491..419183 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 419183..419584 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 419554..419697 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 419772..420185 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 420399..420650 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 420640..420927 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 414528..414686 (159 bp)
Type: Others
Protein ID: WP_001894455.1
Type: Others
Protein ID: WP_001894455.1
Location: 415037..415195 (159 bp)
Type: Others
Protein ID: WP_001882309.1
Type: Others
Protein ID: WP_001882309.1
Location: 417000..417980 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF73_RS15950 | 410789..410992 | + | 204 | WP_001911745.1 | hypothetical protein | - |
GTF73_RS15955 | 411273..411446 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
GTF73_RS15960 | 411806..412075 | + | 270 | WP_001198131.1 | hypothetical protein | - |
GTF73_RS15965 | 412386..412472 | + | 87 | WP_134820423.1 | DUF645 family protein | - |
GTF73_RS15970 | 412472..412564 | + | 93 | Protein_437 | DUF645 family protein | - |
GTF73_RS15975 | 412773..413159 | + | 387 | WP_000703163.1 | VOC family protein | - |
GTF73_RS15980 | 413361..413603 | + | 243 | WP_000107461.1 | hypothetical protein | - |
GTF73_RS15985 | 413774..414151 | + | 378 | WP_000411109.1 | hypothetical protein | - |
GTF73_RS15990 | 414331..414552 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
GTF73_RS15995 | 414528..414686 | - | 159 | WP_001894455.1 | DUF1196 family protein | - |
GTF73_RS16000 | 414718..414831 | + | 114 | WP_001889158.1 | hypothetical protein | - |
GTF73_RS16005 | 414780..415007 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GTF73_RS16010 | 415037..415195 | - | 159 | WP_001882309.1 | DUF1196 family protein | - |
GTF73_RS16015 | 415348..415680 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF73_RS16020 | 415667..415981 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
GTF73_RS16025 | 416118..416552 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GTF73_RS16030 | 416720..416875 | + | 156 | WP_000751734.1 | hypothetical protein | - |
GTF73_RS16035 | 417000..417980 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GTF73_RS16040 | 418048..418320 | + | 273 | Protein_451 | CatB-related O-acetyltransferase | - |
GTF73_RS16045 | 418491..419183 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
GTF73_RS16050 | 419183..419584 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GTF73_RS16055 | 419554..419697 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GTF73_RS16060 | 419772..420185 | + | 414 | WP_000049417.1 | VOC family protein | - |
GTF73_RS16065 | 420399..420650 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF73_RS16070 | 420640..420927 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306901..436162 | 129261 | |
inside | Integron | - | - | 311981..435786 | 123805 | ||
flank | IS/Tn | - | - | 417000..417980 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T145833 WP_000843587.1 NZ_CP047298:415348-415680 [Vibrio cholerae O1 biovar El Tor]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T145833 NZ_CP062702:403407-403934 [Escherichia coli O157:H7]
ATGGATGATCTGACGATAGAGATTCTGACCGATGATGCAGATTATGATCTACAGCGATTCGACTGCGGCGAGGAAGCGTT
AAATCTCTTTCTGACGACACATCTCGTTCGTCAACATCGCAACAAAATTCTGCGAGCGTATATCCTTTGTCGCAACACTC
CAGAACGTCAGGTGCTGGGATATTACACATTATGCGGCAGTTGTTTTGAACGAGCCGCATTGCCCTCGAAATCGAAACAG
AAAAAAATTCCCTACAAAAATATTCCCAGCGTTACTCTTGGGCGTCTGGCAATTGATCGTTCATTACAGGGGCAGGGATG
GGGAGCAACACTGGTTGCTCATGCCATGAAAGTCGTCTGGTCAGCCTCTTTAGCGGTAGGTATTCACGGTCTTTTTGTCG
AGGCGCTGAATGAAAAAGCCCATACGTTTTATAAATCGCTGGGCTTTATCCCTTTAGTCGGGGAAAACGAAAATGCGTTA
TTTTTCCCAACCAAATCCATTGAACTGCTTTTTACACAGAGCGATTAA
ATGGATGATCTGACGATAGAGATTCTGACCGATGATGCAGATTATGATCTACAGCGATTCGACTGCGGCGAGGAAGCGTT
AAATCTCTTTCTGACGACACATCTCGTTCGTCAACATCGCAACAAAATTCTGCGAGCGTATATCCTTTGTCGCAACACTC
CAGAACGTCAGGTGCTGGGATATTACACATTATGCGGCAGTTGTTTTGAACGAGCCGCATTGCCCTCGAAATCGAAACAG
AAAAAAATTCCCTACAAAAATATTCCCAGCGTTACTCTTGGGCGTCTGGCAATTGATCGTTCATTACAGGGGCAGGGATG
GGGAGCAACACTGGTTGCTCATGCCATGAAAGTCGTCTGGTCAGCCTCTTTAGCGGTAGGTATTCACGGTCTTTTTGTCG
AGGCGCTGAATGAAAAAGCCCATACGTTTTATAAATCGCTGGGCTTTATCCCTTTAGTCGGGGAAAACGAAAATGCGTTA
TTTTTCCCAACCAAATCCATTGAACTGCTTTTTACACAGAGCGATTAA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT145833 WP_000071008.1 NZ_CP047298:415667-415981 [Vibrio cholerae O1 biovar El Tor]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT145833 NZ_CP062702:403134-403400 [Escherichia coli O157:H7]
ATGTCTGCTGTTAAAAAGCAGCGTATCGATCTGCGTTTAACTGACGATGACAAAAGTATGATTGAGGAAGCGGCAGCGAT
ATCTAATCAGTCCGTCAGCCAATTTATGTTGAACAGCGCTTCGCAGCGGGCTGCGGAAGTGATTGAACAGCATCGGCGGG
TGATCCTCAATGAGGAATCCTGGACGCGGGTGATGGATGCGCTGAGTAATCCACCGTCACCAGGTGAAAAGCTAAAACGT
GCGGCAAAACGTCTTCAGGGAATGTAA
ATGTCTGCTGTTAAAAAGCAGCGTATCGATCTGCGTTTAACTGACGATGACAAAAGTATGATTGAGGAAGCGGCAGCGAT
ATCTAATCAGTCCGTCAGCCAATTTATGTTGAACAGCGCTTCGCAGCGGGCTGCGGAAGTGATTGAACAGCATCGGCGGG
TGATCCTCAATGAGGAATCCTGGACGCGGGTGATGGATGCGCTGAGTAATCCACCGTCACCAGGTGAAAAGCTAAAACGT
GCGGCAAAACGTCTTCAGGGAATGTAA