Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 68308..68867 | Replicon | chromosome |
Accession | NC_016446 | ||
Organism | Vibrio cholerae O1 str. 2010EL-1786 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9K2M8 |
Locus tag | HJ37_RS14410 | Protein ID | WP_000578476.1 |
Coordinates | 68308..68586 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9L991 |
Locus tag | HJ37_RS14415 | Protein ID | WP_000381183.1 |
Coordinates | 68583..68867 (-) | Length | 95 a.a. |
Genomic Context
Location: 63386..63892 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 64049..64435 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 64692..64895 (204 bp)
Type: Others
Protein ID: WP_001911580.1
Type: Others
Protein ID: WP_001911580.1
Location: 65090..65341 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 65314..65463 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 65610..66035 (426 bp)
Type: Others
Protein ID: WP_000415750.1
Type: Others
Protein ID: WP_000415750.1
Location: 66241..66864 (624 bp)
Type: Others
Protein ID: WP_000247070.1
Type: Others
Protein ID: WP_000247070.1
Location: 67077..67556 (480 bp)
Type: Others
Protein ID: WP_000009888.1
Type: Others
Protein ID: WP_000009888.1
Location: 67744..68157 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 69062..69577 (516 bp)
Type: Others
Protein ID: WP_001201520.1
Type: Others
Protein ID: WP_001201520.1
Location: 69642..70238 (597 bp)
Type: Others
Protein ID: WP_000255434.1
Type: Others
Protein ID: WP_000255434.1
Location: 70630..70812 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 71012..71485 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 71500..71592 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 71634..72260 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 72383..73081 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 73091..73201 (111 bp)
Type: Others
Protein ID: WP_079857360.1
Type: Others
Protein ID: WP_079857360.1
Location: 68308..68586 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1
Type: Toxin
Protein ID: WP_000578476.1
Location: 68583..68867 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1
Type: Antitoxin
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HJ37_RS14370 | 63386..63892 | + | 507 | WP_000393074.1 | hypothetical protein | - |
HJ37_RS14375 | 64049..64435 | + | 387 | WP_000703163.1 | VOC family protein | - |
HJ37_RS14380 | 64692..64895 | + | 204 | WP_001911580.1 | hypothetical protein | - |
HJ37_RS14385 | 65090..65341 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
HJ37_RS19425 | 65314..65463 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
HJ37_RS14390 | 65610..66035 | + | 426 | WP_000415750.1 | hypothetical protein | - |
HJ37_RS14395 | 66241..66864 | + | 624 | WP_000247070.1 | DUF1349 domain-containing protein | - |
HJ37_RS14400 | 67077..67556 | + | 480 | WP_000009888.1 | lecithin retinol acyltransferase family protein | - |
HJ37_RS14405 | 67744..68157 | + | 414 | WP_000049420.1 | VOC family protein | - |
HJ37_RS14410 | 68308..68586 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
HJ37_RS14415 | 68583..68867 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
HJ37_RS14420 | 69062..69577 | + | 516 | WP_001201520.1 | lipocalin family protein | - |
HJ37_RS14425 | 69642..70238 | + | 597 | WP_000255434.1 | hypothetical protein | - |
HJ37_RS14430 | 70630..70812 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
HJ37_RS14435 | 71012..71485 | + | 474 | WP_001161076.1 | GrpB family protein | - |
HJ37_RS19440 | 71500..71592 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
HJ37_RS14440 | 71634..72260 | + | 627 | WP_000365424.1 | LysE family translocator | - |
HJ37_RS14445 | 72383..73081 | + | 699 | WP_001890502.1 | hypothetical protein | - |
HJ37_RS19445 | 73091..73201 | + | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31115..136304 | 105189 | |
inside | Integron | catB9 | - | 36195..135928 | 99733 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10819.59 Da Isoelectric Point: 5.1651
>T25709 WP_000578476.1 NC_016446:c68586-68308 [Vibrio cholerae O1 str. 2010EL-1786]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
Download Length: 279 bp
>T25709 NC_016446:c68586-68308 [Vibrio cholerae O1 str. 2010EL-1786]
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10901.25 Da Isoelectric Point: 8.0775
>AT25709 WP_000381183.1 NC_016446:c68867-68583 [Vibrio cholerae O1 str. 2010EL-1786]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
Download Length: 285 bp
>AT25709 NC_016446:c68867-68583 [Vibrio cholerae O1 str. 2010EL-1786]
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9K2M8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A067BL33 |