Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
Location | 852221..852792 | Replicon | chromosome |
Accession | NZ_CP090400 | ||
Organism | Vibrio cholerae strain PanChol |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | LZM82_RS17390 | Protein ID | WP_000351248.1 |
Coordinates | 852221..852622 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | Q8GNG3 |
Locus tag | LZM82_RS17395 | Protein ID | WP_001080654.1 |
Coordinates | 852622..852792 (-) | Length | 57 a.a. |
Genomic Context
Location: 848853..849125 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 849122..849619 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 853825..854805 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 847515..847802 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 847954..848622 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 848639..848701 (63 bp)
Type: Others
Protein ID: Protein_733
Type: Others
Protein ID: Protein_733
Location: 849636..849704 (69 bp)
Type: Others
Protein ID: Protein_736
Type: Others
Protein ID: Protein_736
Location: 849821..849925 (105 bp)
Type: Others
Protein ID: WP_228840819.1
Type: Others
Protein ID: WP_228840819.1
Location: 850116..850238 (123 bp)
Type: Others
Protein ID: Protein_738
Type: Others
Protein ID: Protein_738
Location: 850295..850750 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 850878..851165 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 851155..851406 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 851620..852033 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 852108..852218 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 852221..852622 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 852622..852792 (171 bp)
Type: Antitoxin
Protein ID: WP_001080654.1
Type: Antitoxin
Protein ID: WP_001080654.1
Location: 852916..853314 (399 bp)
Type: Others
Protein ID: Protein_746
Type: Others
Protein ID: Protein_746
Location: 853451..853757 (307 bp)
Type: Others
Protein ID: Protein_747
Type: Others
Protein ID: Protein_747
Location: 854930..855085 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 855253..855687 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 855824..856138 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 856125..856457 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 856798..857025 (228 bp)
Type: Others
Protein ID: WP_073426587.1
Type: Others
Protein ID: WP_073426587.1
Location: 856974..857087 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 857253..857474 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 857483..857597 (115 bp)
Type: Others
Protein ID: Protein_756
Type: Others
Protein ID: Protein_756
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LZM82_RS17320 (LZM82_17320) | 847515..847802 | - | 288 | WP_000426470.1 | hypothetical protein | - |
LZM82_RS17325 (LZM82_17325) | 847954..848622 | - | 669 | WP_000043871.1 | hypothetical protein | - |
LZM82_RS17330 (LZM82_17330) | 848639..848701 | - | 63 | Protein_733 | acetyltransferase | - |
LZM82_RS17335 (LZM82_17335) | 848853..849125 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
LZM82_RS17340 (LZM82_17340) | 849122..849619 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
LZM82_RS17345 (LZM82_17345) | 849636..849704 | - | 69 | Protein_736 | acetyltransferase | - |
LZM82_RS17350 (LZM82_17350) | 849821..849925 | - | 105 | WP_228840819.1 | DUF645 family protein | - |
LZM82_RS17360 (LZM82_17360) | 850116..850238 | - | 123 | Protein_738 | acetyltransferase | - |
LZM82_RS17365 (LZM82_17365) | 850295..850750 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
LZM82_RS17370 (LZM82_17370) | 850878..851165 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
LZM82_RS17375 (LZM82_17375) | 851155..851406 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
LZM82_RS17380 (LZM82_17380) | 851620..852033 | - | 414 | WP_000049417.1 | VOC family protein | - |
LZM82_RS17385 (LZM82_17385) | 852108..852218 | - | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
LZM82_RS17390 (LZM82_17390) | 852221..852622 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
LZM82_RS17395 (LZM82_17395) | 852622..852792 | - | 171 | WP_001080654.1 | hypothetical protein | Antitoxin |
LZM82_RS17400 (LZM82_17400) | 852916..853314 | - | 399 | Protein_746 | GNAT family N-acetyltransferase | - |
LZM82_RS17405 (LZM82_17405) | 853451..853757 | - | 307 | Protein_747 | CatB-related O-acetyltransferase | - |
LZM82_RS17410 (LZM82_17410) | 853825..854805 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
LZM82_RS17415 (LZM82_17415) | 854930..855085 | - | 156 | WP_000751734.1 | hypothetical protein | - |
LZM82_RS17420 (LZM82_17420) | 855253..855687 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
LZM82_RS17425 (LZM82_17425) | 855824..856138 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
LZM82_RS17430 (LZM82_17430) | 856125..856457 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
LZM82_RS17435 (LZM82_17435) | 856798..857025 | - | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
LZM82_RS17440 (LZM82_17440) | 856974..857087 | - | 114 | WP_001889158.1 | hypothetical protein | - |
LZM82_RS17445 (LZM82_17445) | 857253..857474 | - | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
LZM82_RS17450 (LZM82_17450) | 857483..857597 | - | 115 | Protein_756 | acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 835643..943910 | 108267 | |
inside | Integron | - | - | 836019..937068 | 101049 | ||
flank | IS/Tn | - | - | 853825..854805 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T230641 WP_000351248.1 NZ_CP090400:c852622-852221 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T230641 NZ_CP125221:36548-36853 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGCAGTTTAAGGTTTACACCTGTAAAAGGGAGAGTCGCTACCGGCTGTTTGTGGACGTGCAGAGCGACATCATTGACAC
CCCCGGACGGCGGATGGCTGTCCCGCTGGTCAGCGCCCGTCTGCTGTCGGAAAAGGTTCCCCGCGATCTTTACCCGGTGA
TGCATATCGGGGATGAGCCTTACCGCCTGCTGACCACGGATATGACCAGTGTGCCGGCCACCGTCATCGGGGAAGAGGTG
GCCGATCTCAGCCTCCGGGAGAACGATATCAAAAACGCCATTAACCTGATGTTCCGGGGGATCTGA
ATGCAGTTTAAGGTTTACACCTGTAAAAGGGAGAGTCGCTACCGGCTGTTTGTGGACGTGCAGAGCGACATCATTGACAC
CCCCGGACGGCGGATGGCTGTCCCGCTGGTCAGCGCCCGTCTGCTGTCGGAAAAGGTTCCCCGCGATCTTTACCCGGTGA
TGCATATCGGGGATGAGCCTTACCGCCTGCTGACCACGGATATGACCAGTGTGCCGGCCACCGTCATCGGGGAAGAGGTG
GCCGATCTCAGCCTCCGGGAGAACGATATCAAAAACGCCATTAACCTGATGTTCCGGGGGATCTGA
Antitoxin
Download Length: 57 a.a. Molecular weight: 6287.35 Da Isoelectric Point: 10.7274
>AT230641 WP_001080654.1 NZ_CP090400:c852792-852622 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 171 bp
>AT230641 NZ_CP125221:36328-36546 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGAAGCAGCGAATTACAGTGACAGTGGACAGCGACAGCTATCAGCTGCTCAAGGCATACGACGTGAATATCTCCGGTCT
GGTCAGTACGACCATGCAGAACGAAGCCCGCCGTCTGCGAGCCGAACGCTGGCAGGAAGAAAATCGGGAAGGTATGGCTG
AGGTGGCCAGCTTTATAGAGGCTAACGGATCGTTTGCTGACGACAACAGGAACTGGTGA
ATGAAGCAGCGAATTACAGTGACAGTGGACAGCGACAGCTATCAGCTGCTCAAGGCATACGACGTGAATATCTCCGGTCT
GGTCAGTACGACCATGCAGAACGAAGCCCGCCGTCTGCGAGCCGAACGCTGGCAGGAAGAAAATCGGGAAGGTATGGCTG
AGGTGGCCAGCTTTATAGAGGCTAACGGATCGTTTGCTGACGACAACAGGAACTGGTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SJJ1 |