Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 332133..332631 | Replicon | chromosome |
Accession | NZ_CP024163 | ||
Organism | Vibrio cholerae strain E7946 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | CSW01_RS15755 | Protein ID | WP_000589156.1 |
Coordinates | 332133..332399 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | CSW01_RS15760 | Protein ID | WP_000643598.1 |
Coordinates | 332386..332631 (+) | Length | 82 a.a. |
Genomic Context
Location: 327554..327760 (207 bp)
Type: Others
Protein ID: Protein_289
Type: Others
Protein ID: Protein_289
Location: 327960..328061 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 328051..328437 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 328632..328883 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 328856..329005 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 329097..329339 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 329591..329869 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 330244..330387 (144 bp)
Type: Others
Protein ID: Protein_296
Type: Others
Protein ID: Protein_296
Location: 330441..330479 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 330691..331158 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 331286..331948 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 332133..332399 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 332386..332631 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 332727..333521 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 333624..333752 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 333813..333995 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 334211..335215 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 335368..335727 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 336000..336233 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 336501..337007 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 337164..337550 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSW01_RS19805 | 327554..327760 | + | 207 | Protein_289 | DUF3709 domain-containing protein | - |
CSW01_RS15690 | 327960..328061 | + | 102 | WP_001921603.1 | hypothetical protein | - |
CSW01_RS15695 | 328051..328437 | + | 387 | WP_000703163.1 | VOC family protein | - |
CSW01_RS15700 | 328632..328883 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
CSW01_RS15705 | 328856..329005 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
CSW01_RS15710 | 329097..329339 | + | 243 | WP_000107461.1 | hypothetical protein | - |
CSW01_RS15715 | 329591..329869 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
CSW01_RS19945 | 330244..330387 | + | 144 | Protein_296 | DUF645 family protein | - |
CSW01_RS19950 | 330441..330479 | + | 39 | WP_082798268.1 | hypothetical protein | - |
CSW01_RS15740 | 330691..331158 | + | 468 | WP_001289288.1 | OsmC family protein | - |
CSW01_RS15745 | 331286..331948 | + | 663 | WP_000960654.1 | hypothetical protein | - |
CSW01_RS15755 | 332133..332399 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
CSW01_RS15760 | 332386..332631 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
CSW01_RS15765 | 332727..333521 | + | 795 | WP_001911581.1 | hypothetical protein | - |
CSW01_RS19955 | 333624..333752 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
CSW01_RS15780 | 333813..333995 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
CSW01_RS15785 | 334211..335215 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
CSW01_RS15795 | 335368..335727 | + | 360 | WP_001071541.1 | VOC family protein | - |
CSW01_RS15800 | 336000..336233 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
CSW01_RS15805 | 336501..337007 | + | 507 | WP_000393074.1 | hypothetical protein | - |
CSW01_RS15810 | 337164..337550 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304226..433944 | 129718 | |
inside | Integron | - | - | 309306..433568 | 124262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T87019 WP_000589156.1 NZ_CP024163:332133-332399 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T87019 NZ_CP024163:332133-332399 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT87019 WP_000643598.1 NZ_CP024163:332386-332631 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT87019 NZ_CP024163:332386-332631 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |