Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 329004..329544 | Replicon | chromosome |
Accession | NZ_CP047304 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain E7946 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | GTF74_RS15225 | Protein ID | WP_000277238.1 |
Coordinates | 329004..329273 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | GTF74_RS15230 | Protein ID | WP_001258569.1 |
Coordinates | 329266..329544 (-) | Length | 93 a.a. |
Genomic Context
Location: 324494..324880 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 324937..325050 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 324999..325280 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 325538..326074 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 326211..326726 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 328035..328160 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 328176..328214 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 328410..328856 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 329830..330108 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 330360..330566 (207 bp)
Type: Others
Protein ID: Protein_294
Type: Others
Protein ID: Protein_294
Location: 330766..330867 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 330857..331243 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 331438..331689 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 331662..331811 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 331903..332145 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 332397..332675 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 333050..333193 (144 bp)
Type: Others
Protein ID: Protein_301
Type: Others
Protein ID: Protein_301
Location: 333247..333285 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 333497..333964 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 324008..324250 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 325256..325414 (159 bp)
Type: Others
Protein ID: WP_001886450.1
Type: Others
Protein ID: WP_001886450.1
Location: 326876..327373 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 327370..327642 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 329004..329273 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 329266..329544 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF74_RS15165 | 324008..324250 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF74_RS15170 | 324494..324880 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
GTF74_RS15175 | 324937..325050 | + | 114 | WP_001900214.1 | hypothetical protein | - |
GTF74_RS15180 | 324999..325280 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
GTF74_RS15185 | 325256..325414 | - | 159 | WP_001886450.1 | DUF1196 family protein | - |
GTF74_RS15190 | 325538..326074 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
GTF74_RS15195 | 326211..326726 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
GTF74_RS15200 | 326876..327373 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GTF74_RS15205 | 327370..327642 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GTF74_RS15210 | 328035..328160 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
GTF74_RS15215 | 328176..328214 | + | 39 | WP_106019118.1 | hypothetical protein | - |
GTF74_RS15220 | 328410..328856 | + | 447 | WP_000006157.1 | hypothetical protein | - |
GTF74_RS15225 | 329004..329273 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
GTF74_RS15230 | 329266..329544 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
GTF74_RS15235 | 329830..330108 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
GTF74_RS15240 | 330360..330566 | + | 207 | Protein_294 | DUF3709 domain-containing protein | - |
GTF74_RS15245 | 330766..330867 | + | 102 | WP_001921603.1 | hypothetical protein | - |
GTF74_RS15250 | 330857..331243 | + | 387 | WP_000703163.1 | VOC family protein | - |
GTF74_RS15255 | 331438..331689 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
GTF74_RS15260 | 331662..331811 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
GTF74_RS15265 | 331903..332145 | + | 243 | WP_000107461.1 | hypothetical protein | - |
GTF74_RS15270 | 332397..332675 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
GTF74_RS15275 | 333050..333193 | + | 144 | Protein_301 | DUF645 family protein | - |
GTF74_RS15280 | 333247..333285 | + | 39 | WP_082798268.1 | hypothetical protein | - |
GTF74_RS15285 | 333497..333964 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 307032..436751 | 129719 | |
inside | Integron | - | - | 312112..436375 | 124263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T145885 WP_000277238.1 NZ_CP047304:c329273-329004 [Vibrio cholerae O1 biovar El Tor]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T145885 NZ_CP062705:4829141-4829482 [Escherichia coli O157:H7]
ATGACTGATACGCATTCTATTGCACAACCGTTCGAAGCAGAAGTCTCCCCGGCAAATAACCGTCAATTAACCGTGAGTTA
TGCGAGTCGTTACCCGGATTACAGCCGTATTCCCGCCATCACCCTGAAAGGTCAGTGGCTGGAAGCCGCCGGTTTTGCCA
CCGGCACGGTGGTAGATGTCAAAGTGATGGAAGGCTGTATTGTCCTCACCGCCCAACCACCCGCCGCCGCCGAGAGCGAA
CTGATGCAGTCGCTGCGCCAGGTGTGCAAGCTGTCGGCGCGTAAACAAAGGCAGGTGCAGGAGTTTATTGGGGTGATTGC
GGGTAAACAGAAAGTTGCCTGA
ATGACTGATACGCATTCTATTGCACAACCGTTCGAAGCAGAAGTCTCCCCGGCAAATAACCGTCAATTAACCGTGAGTTA
TGCGAGTCGTTACCCGGATTACAGCCGTATTCCCGCCATCACCCTGAAAGGTCAGTGGCTGGAAGCCGCCGGTTTTGCCA
CCGGCACGGTGGTAGATGTCAAAGTGATGGAAGGCTGTATTGTCCTCACCGCCCAACCACCCGCCGCCGCCGAGAGCGAA
CTGATGCAGTCGCTGCGCCAGGTGTGCAAGCTGTCGGCGCGTAAACAAAGGCAGGTGCAGGAGTTTATTGGGGTGATTGC
GGGTAAACAGAAAGTTGCCTGA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT145885 WP_001258569.1 NZ_CP047304:c329544-329266 [Vibrio cholerae O1 biovar El Tor]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT145885 NZ_CP062705:c4829146-4829070 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |