Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 115088..115635 | Replicon | chromosome |
Accession | NZ_CP013316 | ||
Organism | Vibrio cholerae strain M2140 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C3LV30 |
Locus tag | ASZ83_RS14560 | Protein ID | WP_000229318.1 |
Coordinates | 115333..115635 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | ASZ83_RS14555 | Protein ID | WP_000861987.1 |
Coordinates | 115088..115345 (+) | Length | 86 a.a. |
Genomic Context
Location: 110231..110344 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 110293..110574 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 110832..111368 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 111505..112020 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 113329..113454 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 113470..113508 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 113704..114150 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 115088..115345 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 115333..115635 (303 bp)
Type: Toxin
Protein ID: WP_000229318.1
Type: Toxin
Protein ID: WP_000229318.1
Location: 115924..116148 (225 bp)
Type: Others
Protein ID: WP_001894423.1
Type: Others
Protein ID: WP_001894423.1
Location: 116592..116711 (120 bp)
Type: Others
Protein ID: WP_071919600.1
Type: Others
Protein ID: WP_071919600.1
Location: 116715..116768 (54 bp)
Type: Others
Protein ID: Protein_123
Type: Others
Protein ID: Protein_123
Location: 117370..118374 (1005 bp)
Type: Others
Protein ID: WP_000964931.1
Type: Others
Protein ID: WP_000964931.1
Location: 119149..119329 (181 bp)
Type: Others
Protein ID: Protein_125
Type: Others
Protein ID: Protein_125
Location: 119596..119883 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 119894..120211 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 120208..120318 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 112170..112667 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 112664..112936 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 114298..114567 (270 bp)
Type: Others
Protein ID: WP_000277238.1
Type: Others
Protein ID: WP_000277238.1
Location: 114560..114838 (279 bp)
Type: Others
Protein ID: WP_001258569.1
Type: Others
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ83_RS14500 | 110231..110344 | + | 114 | WP_001900214.1 | hypothetical protein | - |
ASZ83_RS14505 | 110293..110574 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
ASZ83_RS14515 | 110832..111368 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
ASZ83_RS14520 | 111505..112020 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
ASZ83_RS14525 | 112170..112667 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ83_RS14530 | 112664..112936 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ83_RS19990 | 113329..113454 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
ASZ83_RS19995 | 113470..113508 | + | 39 | WP_106019118.1 | hypothetical protein | - |
ASZ83_RS14540 | 113704..114150 | + | 447 | WP_000006157.1 | hypothetical protein | - |
ASZ83_RS14545 | 114298..114567 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | - |
ASZ83_RS14550 | 114560..114838 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ83_RS14555 | 115088..115345 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ83_RS14560 | 115333..115635 | + | 303 | WP_000229318.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ83_RS14565 | 115924..116148 | + | 225 | WP_001894423.1 | DUF3709 domain-containing protein | - |
ASZ83_RS14570 | 116592..116711 | + | 120 | WP_071919600.1 | DUF645 family protein | - |
ASZ83_RS20010 | 116715..116768 | + | 54 | Protein_123 | DUF645 family protein | - |
ASZ83_RS14585 | 117370..118374 | + | 1005 | WP_000964931.1 | LD-carboxypeptidase | - |
ASZ83_RS14595 | 119149..119329 | + | 181 | Protein_125 | DUF645 family protein | - |
ASZ83_RS14600 | 119596..119883 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ83_RS14605 | 119894..120211 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
ASZ83_RS20435 | 120208..120318 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 87981..224211 | 136230 | |
inside | Integron | - | - | 93061..221594 | 128533 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11751.69 Da Isoelectric Point: 5.1972
>T58375 WP_000229318.1 NZ_CP013316:115333-115635 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRIPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRIPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T58375 NZ_CP013316:115333-115635 [Vibrio cholerae]
ATGGTTGAAATAATTTGGACGGAGCCGGCTCTATCCGACCTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCATCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAATCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCCGGCTCTATCCGACCTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCATCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAATCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT58375 WP_000861987.1 NZ_CP013316:115088-115345 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT58375 NZ_CP013316:115088-115345 [Vibrio cholerae]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | C3LV30 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |