Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 322682..323260 | Replicon | chromosome |
Accession | NZ_LT907990 | ||
Organism | Vibrio cholerae strain A19 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | ALC86_RS15355 | Protein ID | WP_001180243.1 |
Coordinates | 322682..322999 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | ALC86_RS15360 | Protein ID | WP_000557292.1 |
Coordinates | 323018..323260 (-) | Length | 81 a.a. |
Genomic Context
Location: 318206..318388 (183 bp)
Type: Others
Protein ID: WP_000923340.1
Type: Others
Protein ID: WP_000923340.1
Location: 318742..318924 (183 bp)
Type: Others
Protein ID: WP_000923153.1
Type: Others
Protein ID: WP_000923153.1
Location: 319119..319796 (678 bp)
Type: Others
Protein ID: WP_000254617.1
Type: Others
Protein ID: WP_000254617.1
Location: 319958..321166 (1209 bp)
Type: Others
Protein ID: WP_000272282.1
Type: Others
Protein ID: WP_000272282.1
Location: 321328..322032 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Location: 322190..322528 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 323504..323890 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 323947..324060 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 324009..324290 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 324548..325084 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 325221..325736 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 327045..327170 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 327186..327224 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 327420..327866 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 322682..322999 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 323018..323260 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Location: 325886..326383 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 326380..326652 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ALC86_RS15325 | 318206..318388 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
ALC86_RS15330 | 318742..318924 | + | 183 | WP_000923153.1 | DUF645 family protein | - |
ALC86_RS15335 | 319119..319796 | + | 678 | WP_000254617.1 | HNH endonuclease | - |
ALC86_RS15340 | 319958..321166 | + | 1209 | WP_000272282.1 | deoxyguanosinetriphosphate triphosphohydrolase family protein | - |
ALC86_RS15345 | 321328..322032 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
ALC86_RS15350 | 322190..322528 | + | 339 | WP_000713853.1 | hypothetical protein | - |
ALC86_RS15355 | 322682..322999 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ALC86_RS15360 | 323018..323260 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ALC86_RS15365 | 323504..323890 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
ALC86_RS15370 | 323947..324060 | + | 114 | WP_001900214.1 | hypothetical protein | - |
ALC86_RS15375 | 324009..324290 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
ALC86_RS15385 | 324548..325084 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
ALC86_RS15390 | 325221..325736 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
ALC86_RS15400 | 325886..326383 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ALC86_RS15405 | 326380..326652 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ALC86_RS15415 | 327045..327170 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
ALC86_RS19535 | 327186..327224 | + | 39 | WP_106019118.1 | hypothetical protein | - |
ALC86_RS15425 | 327420..327866 | + | 447 | WP_000006157.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T293821 WP_001180243.1 NZ_LT907990:c322999-322682 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |