Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafN(antitoxin) |
Location | 388062..388699 | Replicon | chromosome |
Accession | NZ_CP047298 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain C6709 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | GTF73_RS15775 | Protein ID | WP_000869997.1 |
Coordinates | 388340..388699 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D0IIK3 |
Locus tag | GTF73_RS15770 | Protein ID | WP_000086649.1 |
Coordinates | 388062..388343 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF73_RS15735 | 383184..383543 | + | 360 | WP_001071514.1 | VOC family protein | - |
GTF73_RS15740 | 383726..384049 | + | 324 | WP_001889156.1 | DUF3709 domain-containing protein | - |
GTF73_RS15745 | 384330..384866 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
GTF73_RS15750 | 385627..385809 | + | 183 | WP_000947517.1 | DUF645 family protein | - |
GTF73_RS15755 | 385928..386713 | + | 786 | WP_001176447.1 | hypothetical protein | - |
GTF73_RS15760 | 386815..387177 | + | 363 | WP_170831679.1 | DUF4144 domain-containing protein | - |
GTF73_RS15765 | 387423..387848 | + | 426 | WP_000735184.1 | hypothetical protein | - |
GTF73_RS15770 | 388062..388343 | + | 282 | WP_000086649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GTF73_RS15775 | 388340..388699 | + | 360 | WP_000869997.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF73_RS15780 | 388804..389127 | + | 324 | WP_001999495.1 | DUF3709 domain-containing protein | - |
GTF73_RS15785 | 389413..389808 | + | 396 | WP_000870868.1 | DUF3465 domain-containing protein | - |
GTF73_RS15790 | 389875..389989 | + | 115 | Protein_401 | acetyltransferase | - |
GTF73_RS15795 | 389998..390219 | + | 222 | WP_043987927.1 | DUF1289 domain-containing protein | - |
GTF73_RS15800 | 390195..390353 | - | 159 | WP_001909351.1 | DUF1196 family protein | - |
GTF73_RS15805 | 390583..391008 | + | 426 | WP_000415748.1 | hypothetical protein | - |
GTF73_RS15810 | 391334..391567 | + | 234 | WP_001999499.1 | DUF3709 domain-containing protein | - |
GTF73_RS15815 | 391756..392151 | + | 396 | WP_001889207.1 | DUF4144 domain-containing protein | - |
GTF73_RS15820 | 392370..392759 | + | 390 | WP_000491261.1 | VOC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306901..436162 | 129261 | |
inside | Integron | - | - | 311981..435786 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13608.84 Da Isoelectric Point: 8.1459
>T145831 WP_000869997.1 NZ_CP047298:388340-388699 [Vibrio cholerae O1 biovar El Tor]
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTLRQEQTVNPPHNKRLKRDCQRVAFPVPLSRGGCSCCV
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTLRQEQTVNPPHNKRLKRDCQRVAFPVPLSRGGCSCCV
Download Length: 360 bp
>T145831 NZ_CP062702:278537-278644 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 94 a.a. Molecular weight: 10361.93 Da Isoelectric Point: 5.1548
>AT145831 WP_000086649.1 NZ_CP047298:388062-388343 [Vibrio cholerae O1 biovar El Tor]
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK
Download Length: 282 bp
>AT145831 NZ_CP062702:c278489-278423 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|