Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 327985..328525 | Replicon | chromosome II |
Accession | NC_016945 | ||
Organism | Vibrio cholerae IEC224 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | O3Y_RS15480 | Protein ID | WP_000277238.1 |
Coordinates | 327985..328254 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | O3Y_RS15485 | Protein ID | WP_001258569.1 |
Coordinates | 328247..328525 (-) | Length | 93 a.a. |
Genomic Context
Location: 323475..323861 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 323918..324031 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 323980..324261 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 324519..325055 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 325192..325707 (516 bp)
Type: Others
Protein ID: WP_001201510.1
Type: Others
Protein ID: WP_001201510.1
Location: 327016..327141 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 327157..327195 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 327391..327837 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 328811..329089 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 329341..329547 (207 bp)
Type: Others
Protein ID: Protein_292
Type: Others
Protein ID: Protein_292
Location: 329747..329848 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 329838..330224 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 330419..330670 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 330643..330792 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 330884..331126 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 331378..331656 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 332031..332174 (144 bp)
Type: Others
Protein ID: Protein_299
Type: Others
Protein ID: Protein_299
Location: 332228..332266 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 332478..332945 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 322989..323231 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 325857..326354 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 326351..326623 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 327985..328254 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 328247..328525 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Y_RS15430 | 322989..323231 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
O3Y_RS15435 | 323475..323861 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
O3Y_RS19615 | 323918..324031 | + | 114 | WP_001900214.1 | hypothetical protein | - |
O3Y_RS15440 | 323980..324261 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
O3Y_RS15450 | 324519..325055 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
O3Y_RS15455 | 325192..325707 | + | 516 | WP_001201510.1 | lipocalin family protein | - |
O3Y_RS15460 | 325857..326354 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
O3Y_RS15465 | 326351..326623 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
O3Y_RS20140 | 327016..327141 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
O3Y_RS20145 | 327157..327195 | + | 39 | WP_106019118.1 | hypothetical protein | - |
O3Y_RS15475 | 327391..327837 | + | 447 | WP_000006157.1 | hypothetical protein | - |
O3Y_RS15480 | 327985..328254 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
O3Y_RS15485 | 328247..328525 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
O3Y_RS19625 | 328811..329089 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
O3Y_RS20160 | 329341..329547 | + | 207 | Protein_292 | DUF3709 domain-containing protein | - |
O3Y_RS20165 | 329747..329848 | + | 102 | WP_001921603.1 | hypothetical protein | - |
O3Y_RS15490 | 329838..330224 | + | 387 | WP_000703163.1 | VOC family protein | - |
O3Y_RS15495 | 330419..330670 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
O3Y_RS19635 | 330643..330792 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
O3Y_RS15500 | 330884..331126 | + | 243 | WP_000107461.1 | hypothetical protein | - |
O3Y_RS15505 | 331378..331656 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
O3Y_RS20580 | 332031..332174 | + | 144 | Protein_299 | DUF645 family protein | - |
O3Y_RS20585 | 332228..332266 | + | 39 | WP_082798268.1 | hypothetical protein | - |
O3Y_RS15515 | 332478..332945 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304637..435582 | 130945 | |
inside | Integron | - | - | 309717..435206 | 125489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T26145 WP_000277238.1 NC_016945:c328254-327985 [Vibrio cholerae IEC224]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T26145 NC_016945:c328254-327985 [Vibrio cholerae IEC224]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT26145 WP_001258569.1 NC_016945:c328525-328247 [Vibrio cholerae IEC224]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT26145 NC_016945:c328525-328247 [Vibrio cholerae IEC224]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |