Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 415937..416570 | Replicon | chromosome |
Accession | NZ_CP047304 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain E7946 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | GTF74_RS16005 | Protein ID | WP_000843587.1 |
Coordinates | 415937..416269 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | GTF74_RS16010 | Protein ID | WP_000071008.1 |
Coordinates | 416256..416570 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF74_RS15940 | 411378..411581 | + | 204 | WP_001911745.1 | hypothetical protein | - |
GTF74_RS15945 | 411862..412035 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
GTF74_RS15950 | 412395..412664 | + | 270 | WP_001198131.1 | hypothetical protein | - |
GTF74_RS15955 | 412975..413061 | + | 87 | WP_134820423.1 | DUF645 family protein | - |
GTF74_RS15960 | 413061..413153 | + | 93 | Protein_438 | DUF645 family protein | - |
GTF74_RS15965 | 413362..413748 | + | 387 | WP_000703163.1 | VOC family protein | - |
GTF74_RS15970 | 413950..414192 | + | 243 | WP_000107461.1 | hypothetical protein | - |
GTF74_RS15975 | 414363..414740 | + | 378 | WP_000411109.1 | hypothetical protein | - |
GTF74_RS15980 | 414920..415141 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
GTF74_RS15985 | 415117..415275 | - | 159 | WP_001894455.1 | DUF1196 family protein | - |
GTF74_RS15990 | 415307..415420 | + | 114 | WP_001889158.1 | hypothetical protein | - |
GTF74_RS15995 | 415369..415596 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GTF74_RS16000 | 415626..415784 | - | 159 | WP_001882309.1 | DUF1196 family protein | - |
GTF74_RS16005 | 415937..416269 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF74_RS16010 | 416256..416570 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
GTF74_RS16015 | 416707..417141 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GTF74_RS16020 | 417309..417464 | + | 156 | WP_000751734.1 | hypothetical protein | - |
GTF74_RS16025 | 417589..418569 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GTF74_RS16030 | 418637..418909 | + | 273 | Protein_452 | CatB-related O-acetyltransferase | - |
GTF74_RS16035 | 419080..419772 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
GTF74_RS16040 | 419772..420173 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GTF74_RS16045 | 420143..420286 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GTF74_RS16050 | 420361..420774 | + | 414 | WP_000049417.1 | VOC family protein | - |
GTF74_RS16055 | 420988..421239 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF74_RS16060 | 421229..421516 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 307032..436751 | 129719 | |
inside | Integron | - | - | 312112..436375 | 124263 | ||
flank | IS/Tn | - | - | 417589..418569 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T145893 WP_000843587.1 NZ_CP047304:415937-416269 [Vibrio cholerae O1 biovar El Tor]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T145893 NZ_CP062708:284691-284798 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT145893 WP_000071008.1 NZ_CP047304:416256-416570 [Vibrio cholerae O1 biovar El Tor]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT145893 NZ_CP062708:c284643-284577 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|