Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 434436..434840 | Replicon | chromosome |
Accession | NZ_CP047300 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain P27459 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | GTF71_RS15855 | Protein ID | WP_001114075.1 |
Coordinates | 434571..434840 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | GTF71_RS15850 | Protein ID | WP_099607150.1 |
Coordinates | 434436..434540 (+) | Length | 35 a.a. |
Genomic Context
Location: 429937..430854 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 431011..431400 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 431536..431745 (210 bp)
Type: Others
Protein ID: Protein_475
Type: Others
Protein ID: Protein_475
Location: 431864..432301 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 432365..432583 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 432758..433630 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 433780..434379 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 434436..434540 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 434571..434840 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 434834..435355 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 435654..435779 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 436030..436425 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 437317..437832 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 437889..437984 (96 bp)
Type: Others
Protein ID: WP_099607151.1
Type: Others
Protein ID: WP_099607151.1
Location: 438016..438429 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 436564..436842 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 436839..437123 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 438436..438568 (133 bp)
Type: Others
Protein ID: Protein_490
Type: Others
Protein ID: Protein_490
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF71_RS15815 | 429937..430854 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
GTF71_RS15820 | 431011..431400 | + | 390 | WP_001081302.1 | hypothetical protein | - |
GTF71_RS15825 | 431536..431745 | + | 210 | Protein_475 | GNAT family N-acetyltransferase | - |
GTF71_RS15830 | 431864..432301 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
GTF71_RS15835 | 432365..432583 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
GTF71_RS15840 | 432758..433630 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
GTF71_RS15845 | 433780..434379 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
GTF71_RS15850 | 434436..434540 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
GTF71_RS15855 | 434571..434840 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
GTF71_RS15860 | 434834..435355 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
GTF71_RS15865 | 435654..435779 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
GTF71_RS15870 | 436030..436425 | + | 396 | WP_001000867.1 | hypothetical protein | - |
GTF71_RS15875 | 436564..436842 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
GTF71_RS15880 | 436839..437123 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
GTF71_RS15885 | 437317..437832 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
GTF71_RS15890 | 437889..437984 | + | 96 | WP_099607151.1 | acetyltransferase | - |
GTF71_RS15895 | 438016..438429 | + | 414 | WP_000049420.1 | VOC family protein | - |
GTF71_RS15900 | 438436..438568 | - | 133 | Protein_490 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306926..439292 | 132366 | |
inside | Integron | - | - | 312006..438916 | 126910 | ||
flank | IS/Tn | - | - | 431864..432301 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T145859 WP_001114075.1 NZ_CP047300:434571-434840 [Vibrio cholerae O1 biovar El Tor]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T145859 NZ_CP062703:52842-53147 [Escherichia coli O157:H7]
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT145859 WP_099607150.1 NZ_CP047300:434436-434540 [Vibrio cholerae O1 biovar El Tor]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT145859 NZ_CP062703:52622-52840 [Escherichia coli O157:H7]
ATGAAGCAGCGTATTACAGTGACAGTTGACAGCGACAGCTATCAGTTGCTCAAGGCATATGATGTCAATATCTCCGGTCT
GGTAAGCACAACCATGCAGAATGAAGCCCGTCGTCTGCGTGCCGAACGCTGGAAAGCGGAAAATCAGGAAGGGATGGCTG
AGGTCGCCCGGTTTATTGAAATGAACGGCTCTTTTGCTGACGAGAACAGGGACTGGTGA
ATGAAGCAGCGTATTACAGTGACAGTTGACAGCGACAGCTATCAGTTGCTCAAGGCATATGATGTCAATATCTCCGGTCT
GGTAAGCACAACCATGCAGAATGAAGCCCGTCGTCTGCGTGCCGAACGCTGGAAAGCGGAAAATCAGGAAGGGATGGCTG
AGGTCGCCCGGTTTATTGAAATGAACGGCTCTTTTGCTGACGAGAACAGGGACTGGTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |