Detailed information of TA system TA145859

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): dhiT-phd/-
• Location: 434436..434840
• Replicon: chromosome
• Accession: NZ_CP047300
• Organism: Vibrio cholerae O1 biovar El Tor strain P27459

Toxin (Protein)

• Gene name: dhiT
• Uniprot ID: A0A086SLD6
• Locus tag: GTF71_RS15855
• Protein ID: WP_001114075.1
• Coordinates: 434571..434840 (+)
• Length: 90 a.a.

Antitoxin (Protein)

• Gene name: phd
• Uniprot ID: -
• Locus tag: GTF71_RS15850
• Protein ID: WP_099607150.1
• Coordinates: 434436..434540 (+)
• Length: 35 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
GTF71_RS15815	429937..430854	+	918	WP_000186333.1	alpha/beta hydrolase	-
GTF71_RS15820	431011..431400	+	390	WP_001081302.1	hypothetical protein	-
GTF71_RS15825	431536..431745	+	210	Protein_475	GNAT family N-acetyltransferase	-
GTF71_RS15830	431864..432301	+	438	WP_000503169.1	IS200/IS605-like element IS1004 family transposase	-
GTF71_RS15835	432365..432583	+	219	WP_071908318.1	GNAT family N-acetyltransferase	-
GTF71_RS15840	432758..433630	+	873	WP_000254716.1	DUF3800 domain-containing protein	-
GTF71_RS15845	433780..434379	+	600	WP_001891245.1	glutathione S-transferase N-terminal domain-containing protein	-
GTF71_RS15850	434436..434540	+	105	WP_099607150.1	acetyltransferase	Antitoxin
GTF71_RS15855	434571..434840	+	270	WP_001114075.1	DUF4160 domain-containing protein	Toxin
GTF71_RS15860	434834..435355	+	522	WP_000921691.1	DUF2442 domain-containing protein	-
GTF71_RS15865	435654..435779	+	126	WP_001905700.1	DUF645 family protein	-
GTF71_RS15870	436030..436425	+	396	WP_001000867.1	hypothetical protein	-
GTF71_RS15875	436564..436842	-	279	WP_000578476.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	-
GTF71_RS15880	436839..437123	-	285	WP_000381183.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	-
GTF71_RS15885	437317..437832	+	516	WP_000343779.1	GNAT family N-acetyltransferase	-
GTF71_RS15890	437889..437984	+	96	WP_099607151.1	acetyltransferase	-
GTF71_RS15895	438016..438429	+	414	WP_000049420.1	VOC family protein	-
GTF71_RS15900	438436..438568	-	133	Protein_490	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	306926..439292	132366
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0	inside	Integron	-	-	312006..438916	126910
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA000179, TA000177, TA000178, TA010035 428335..428772 0	flank	IS/Tn	-	-	431864..432301	437

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF4160 (9-74)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 90 a.a.
• Molecular weight: 10310.94 Da
• Isoelectric Point: 6.6303

>T145859 WP_001114075.1 NZ_CP047300:434571-434840 [Vibrio cholerae O1 biovar El Tor]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC

Nucleotide

• Length: 270 bp

>T145859 NZ_CP062703:52842-53147 [Escherichia coli O157:H7]
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA

Antitoxin

Protein

• Length: 35 a.a.
• Molecular weight: 3991.79 Da
• Isoelectric Point: 9.2853

>AT145859 WP_099607150.1 NZ_CP047300:434436-434540 [Vibrio cholerae O1 biovar El Tor]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL

Nucleotide

• Length: 105 bp

>AT145859 NZ_CP062703:52622-52840 [Escherichia coli O157:H7]
ATGAAGCAGCGTATTACAGTGACAGTTGACAGCGACAGCTATCAGTTGCTCAAGGCATATGATGTCAATATCTCCGGTCT
GGTAAGCACAACCATGCAGAATGAAGCCCGTCGTCTGCGTGCCGAACGCTGGAAAGCGGAAAATCAGGAAGGGATGGCTG
AGGTCGCCCGGTTTATTGAAATGAACGGCTCTTTTGCTGACGAGAACAGGGACTGGTGA

Structures

Toxin

• AlphaFold DB: A0A086SLD6