293827

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 365348..365926 Replicon chromosome
Accession NZ_LT907990
Organism Vibrio cholerae strain A19

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag ALC86_RS15830 Protein ID WP_001180243.1
Coordinates 365348..365665 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag ALC86_RS15835 Protein ID WP_000557292.1
Coordinates 365684..365926 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ALC86_RS15790 360539..360934 + 396 WP_000046952.1 hypothetical protein -
ALC86_RS15795 361237..361418 + 182 Protein_349 DUF645 family protein -
ALC86_RS15800 361595..361990 + 396 WP_000046953.1 hypothetical protein -
ALC86_RS15805 362134..362670 + 537 WP_000644491.1 nucleotidyltransferase family protein -
ALC86_RS15810 362967..363146 + 180 WP_001883039.1 DUF645 family protein -
ALC86_RS15815 363342..363767 + 426 WP_000403014.1 GNAT family N-acetyltransferase -
ALC86_RS15820 363916..364263 + 348 WP_000933409.1 hypothetical protein -
ALC86_RS19580 364410..364703 + 294 WP_125460920.1 hypothetical protein -
ALC86_RS19730 365059..365154 + 96 WP_001907607.1 DUF645 family protein -
ALC86_RS15830 365348..365665 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ALC86_RS15835 365684..365926 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ALC86_RS15840 366168..366677 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
ALC86_RS15845 366734..367387 + 654 WP_000226874.1 hypothetical protein -
ALC86_RS15850 367697..367915 + 219 WP_001917086.1 DUF3709 domain-containing protein -
ALC86_RS15860 368318..368551 + 234 WP_032482776.1 DUF3709 domain-containing protein -
ALC86_RS15865 368976..369156 + 181 Protein_363 DUF645 family protein -
ALC86_RS15870 369423..369710 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
ALC86_RS15875 369721..370038 + 318 WP_001232701.1 HigA family addiction module antidote protein -
ALC86_RS19735 370035..370145 + 111 WP_134814058.1 DUF3265 domain-containing protein -
ALC86_RS15885 370322..370447 + 126 WP_001944767.1 DUF645 family protein -
ALC86_RS19585 370463..370501 + 39 WP_106019119.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T293827 WP_001180243.1 NZ_LT907990:c365665-365348 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT293827 WP_000557292.1 NZ_LT907990:c365926-365684 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References