Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 365348..365926 | Replicon | chromosome |
Accession | NZ_LT907990 | ||
Organism | Vibrio cholerae strain A19 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | ALC86_RS15830 | Protein ID | WP_001180243.1 |
Coordinates | 365348..365665 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | ALC86_RS15835 | Protein ID | WP_000557292.1 |
Coordinates | 365684..365926 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ALC86_RS15790 | 360539..360934 | + | 396 | WP_000046952.1 | hypothetical protein | - |
ALC86_RS15795 | 361237..361418 | + | 182 | Protein_349 | DUF645 family protein | - |
ALC86_RS15800 | 361595..361990 | + | 396 | WP_000046953.1 | hypothetical protein | - |
ALC86_RS15805 | 362134..362670 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ALC86_RS15810 | 362967..363146 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
ALC86_RS15815 | 363342..363767 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
ALC86_RS15820 | 363916..364263 | + | 348 | WP_000933409.1 | hypothetical protein | - |
ALC86_RS19580 | 364410..364703 | + | 294 | WP_125460920.1 | hypothetical protein | - |
ALC86_RS19730 | 365059..365154 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
ALC86_RS15830 | 365348..365665 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ALC86_RS15835 | 365684..365926 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ALC86_RS15840 | 366168..366677 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
ALC86_RS15845 | 366734..367387 | + | 654 | WP_000226874.1 | hypothetical protein | - |
ALC86_RS15850 | 367697..367915 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
ALC86_RS15860 | 368318..368551 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
ALC86_RS15865 | 368976..369156 | + | 181 | Protein_363 | DUF645 family protein | - |
ALC86_RS15870 | 369423..369710 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ALC86_RS15875 | 369721..370038 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
ALC86_RS19735 | 370035..370145 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
ALC86_RS15885 | 370322..370447 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
ALC86_RS19585 | 370463..370501 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T293827 WP_001180243.1 NZ_LT907990:c365665-365348 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |