Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 942836..943414 | Replicon | chromosome |
| Accession | NZ_LT992487 | ||
| Organism | Vibrio cholerae strain 4295STDY6534216 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | O68848 |
| Locus tag | DG247_RS18790 | Protein ID | WP_001180243.1 |
| Coordinates | 943097..943414 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q7DCR7 |
| Locus tag | DG247_RS18785 | Protein ID | WP_000557292.1 |
| Coordinates | 942836..943078 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG247_RS19820 | 938261..938299 | - | 39 | WP_106019119.1 | hypothetical protein | - |
| DG247_RS19825 | 938315..938440 | - | 126 | WP_001944767.1 | DUF645 family protein | - |
| DG247_RS19830 | 938617..938727 | - | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
| DG247_RS18750 | 938724..939041 | - | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
| DG247_RS18755 | 939052..939339 | - | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG247_RS18760 | 939606..939786 | - | 181 | Protein_830 | DUF645 family protein | - |
| DG247_RS18765 | 940211..940444 | - | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
| DG247_RS18770 | 940847..941065 | - | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
| DG247_RS18775 | 941375..942028 | - | 654 | WP_000226874.1 | hypothetical protein | - |
| DG247_RS18780 | 942085..942594 | - | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
| DG247_RS18785 | 942836..943078 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DG247_RS18790 | 943097..943414 | + | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DG247_RS19835 | 943608..943703 | - | 96 | WP_001907607.1 | DUF645 family protein | - |
| DG247_RS19675 | 944059..944352 | - | 294 | WP_125460920.1 | hypothetical protein | - |
| DG247_RS18810 | 944499..944846 | - | 348 | WP_000933409.1 | hypothetical protein | - |
| DG247_RS18815 | 944995..945420 | - | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
| DG247_RS18820 | 945616..945795 | - | 180 | WP_001883039.1 | DUF645 family protein | - |
| DG247_RS18825 | 946092..946628 | - | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
| DG247_RS18830 | 946772..947167 | - | 396 | WP_000046953.1 | hypothetical protein | - |
| DG247_RS18835 | 947344..947525 | - | 182 | Protein_844 | DUF645 family protein | - |
| DG247_RS18840 | 947828..948223 | - | 396 | WP_000046952.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
| inside | Integron | catB9 | - | 897901..987709 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T294359 WP_001180243.1 NZ_LT992487:943097-943414 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9UJR8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7DCR7 |