294359

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 942836..943414 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag DG247_RS18790 Protein ID WP_001180243.1
Coordinates 943097..943414 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag DG247_RS18785 Protein ID WP_000557292.1
Coordinates 942836..943078 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS19820 938261..938299 - 39 WP_106019119.1 hypothetical protein -
DG247_RS19825 938315..938440 - 126 WP_001944767.1 DUF645 family protein -
DG247_RS19830 938617..938727 - 111 WP_134814058.1 DUF3265 domain-containing protein -
DG247_RS18750 938724..939041 - 318 WP_001232701.1 HigA family addiction module antidote protein -
DG247_RS18755 939052..939339 - 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG247_RS18760 939606..939786 - 181 Protein_830 DUF645 family protein -
DG247_RS18765 940211..940444 - 234 WP_032482776.1 DUF3709 domain-containing protein -
DG247_RS18770 940847..941065 - 219 WP_001917086.1 DUF3709 domain-containing protein -
DG247_RS18775 941375..942028 - 654 WP_000226874.1 hypothetical protein -
DG247_RS18780 942085..942594 - 510 WP_000405987.1 GNAT family N-acetyltransferase -
DG247_RS18785 942836..943078 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG247_RS18790 943097..943414 + 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG247_RS19835 943608..943703 - 96 WP_001907607.1 DUF645 family protein -
DG247_RS19675 944059..944352 - 294 WP_125460920.1 hypothetical protein -
DG247_RS18810 944499..944846 - 348 WP_000933409.1 hypothetical protein -
DG247_RS18815 944995..945420 - 426 WP_000403014.1 GNAT family N-acetyltransferase -
DG247_RS18820 945616..945795 - 180 WP_001883039.1 DUF645 family protein -
DG247_RS18825 946092..946628 - 537 WP_000644491.1 nucleotidyltransferase family protein -
DG247_RS18830 946772..947167 - 396 WP_000046953.1 hypothetical protein -
DG247_RS18835 947344..947525 - 182 Protein_844 DUF645 family protein -
DG247_RS18840 947828..948223 - 396 WP_000046952.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T294359 WP_001180243.1 NZ_LT992487:943097-943414 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT294359 WP_000557292.1 NZ_LT992487:942836-943078 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References