Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 131378..131782 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | C4E16_RS15290 | Protein ID | WP_001114075.1 |
Coordinates | 131513..131782 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | C4E16_RS15285 | Protein ID | WP_099607150.1 |
Coordinates | 131378..131482 (+) | Length | 35 a.a. |
Genomic Context
Location: 126879..127796 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 127953..128342 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 128478..128687 (210 bp)
Type: Others
Protein ID: Protein_202
Type: Others
Protein ID: Protein_202
Location: 128806..129243 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 129307..129525 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 129700..130572 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 130722..131321 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 131378..131482 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 131513..131782 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 131776..132297 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 132596..132721 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 132972..133367 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 134259..134774 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 134958..135371 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 133506..133784 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 133781..134065 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS15250 | 126879..127796 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
C4E16_RS15255 | 127953..128342 | + | 390 | WP_001081302.1 | hypothetical protein | - |
C4E16_RS15260 | 128478..128687 | + | 210 | Protein_202 | GNAT family N-acetyltransferase | - |
C4E16_RS15265 | 128806..129243 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
C4E16_RS15270 | 129307..129525 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
C4E16_RS15275 | 129700..130572 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
C4E16_RS15280 | 130722..131321 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
C4E16_RS15285 | 131378..131482 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
C4E16_RS15290 | 131513..131782 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
C4E16_RS15295 | 131776..132297 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
C4E16_RS15300 | 132596..132721 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
C4E16_RS15310 | 132972..133367 | + | 396 | WP_001000867.1 | hypothetical protein | - |
C4E16_RS15315 | 133506..133784 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
C4E16_RS15320 | 133781..134065 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
C4E16_RS15325 | 134259..134774 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
C4E16_RS15335 | 134958..135371 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 | ||
flank | IS/Tn | - | - | 128806..129243 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T95390 WP_001114075.1 NZ_CP026648:131513-131782 [Vibrio cholerae O1 biovar El Tor]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T95390 NZ_CP026648:131513-131782 [Vibrio cholerae O1 biovar El Tor]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT95390 WP_099607150.1 NZ_CP026648:131378-131482 [Vibrio cholerae O1 biovar El Tor]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT95390 NZ_CP026648:131378-131482 [Vibrio cholerae O1 biovar El Tor]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |