Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 280180..280739 | Replicon | chromosome |
Accession | NZ_AP024554 | ||
Organism | Vibrio cholerae strain IDH-03329 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9K2M8 |
Locus tag | K6J80_RS15365 | Protein ID | WP_000578476.1 |
Coordinates | 280461..280739 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9L991 |
Locus tag | K6J80_RS15360 | Protein ID | WP_000381183.1 |
Coordinates | 280180..280464 (+) | Length | 95 a.a. |
Genomic Context
Location: 280180..280464 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1
Type: Antitoxin
Protein ID: WP_000381183.1
Location: 280461..280739 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1
Type: Toxin
Protein ID: WP_000578476.1
Location: 275846..275935 (90 bp)
Type: Others
Protein ID: WP_072606010.1
Type: Others
Protein ID: WP_072606010.1
Location: 275966..276664 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 276787..277413 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 277455..277547 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 277562..278035 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 278235..278417 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 278478..278615 (138 bp)
Type: Others
Protein ID: WP_001890145.1
Type: Others
Protein ID: WP_001890145.1
Location: 278809..279405 (597 bp)
Type: Others
Protein ID: WP_000255434.1
Type: Others
Protein ID: WP_000255434.1
Location: 279470..279931 (462 bp)
Type: Others
Protein ID: WP_001911578.1
Type: Others
Protein ID: WP_001911578.1
Location: 280890..281303 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 281378..281494 (117 bp)
Type: Others
Protein ID: WP_086010882.1
Type: Others
Protein ID: WP_086010882.1
Location: 281491..281970 (480 bp)
Type: Others
Protein ID: WP_000009888.1
Type: Others
Protein ID: WP_000009888.1
Location: 282183..282806 (624 bp)
Type: Others
Protein ID: WP_000247070.1
Type: Others
Protein ID: WP_000247070.1
Location: 283012..283437 (426 bp)
Type: Others
Protein ID: WP_000415750.1
Type: Others
Protein ID: WP_000415750.1
Location: 283584..283733 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 283706..283957 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 284152..284355 (204 bp)
Type: Others
Protein ID: WP_001911580.1
Type: Others
Protein ID: WP_001911580.1
Location: 284612..284998 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 285155..285661 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J80_RS15320 | 275846..275935 | - | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
K6J80_RS15325 | 275966..276664 | - | 699 | WP_001890502.1 | hypothetical protein | - |
K6J80_RS15330 | 276787..277413 | - | 627 | WP_000365424.1 | LysE family translocator | - |
K6J80_RS15335 | 277455..277547 | - | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
K6J80_RS15340 | 277562..278035 | - | 474 | WP_001161076.1 | GrpB family protein | - |
K6J80_RS15345 | 278235..278417 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
K6J80_RS19050 | 278478..278615 | - | 138 | WP_001890145.1 | hypothetical protein | - |
K6J80_RS15350 | 278809..279405 | - | 597 | WP_000255434.1 | hypothetical protein | - |
K6J80_RS15355 | 279470..279931 | - | 462 | WP_001911578.1 | lipocalin family protein | - |
K6J80_RS15360 | 280180..280464 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
K6J80_RS15365 | 280461..280739 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
K6J80_RS15370 | 280890..281303 | - | 414 | WP_000049420.1 | VOC family protein | - |
K6J80_RS19055 | 281378..281494 | - | 117 | WP_086010882.1 | DUF3265 domain-containing protein | - |
K6J80_RS15375 | 281491..281970 | - | 480 | WP_000009888.1 | lecithin retinol acyltransferase family protein | - |
K6J80_RS15380 | 282183..282806 | - | 624 | WP_000247070.1 | DUF1349 domain-containing protein | - |
K6J80_RS15385 | 283012..283437 | - | 426 | WP_000415750.1 | hypothetical protein | - |
K6J80_RS19060 | 283584..283733 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
K6J80_RS15390 | 283706..283957 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
K6J80_RS15395 | 284152..284355 | - | 204 | WP_001911580.1 | hypothetical protein | - |
K6J80_RS15400 | 284612..284998 | - | 387 | WP_000703163.1 | VOC family protein | - |
K6J80_RS15405 | 285155..285661 | - | 507 | WP_000393074.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 213119..319686 | 106567 | |
inside | Integron | - | - | 213119..312856 | 99737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10819.59 Da Isoelectric Point: 5.1651
>T38680 WP_000578476.1 NZ_AP024554:280461-280739 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
Download Length: 279 bp
>T38680 NZ_AP024554:280461-280739 [Vibrio cholerae]
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10901.25 Da Isoelectric Point: 8.0775
>AT38680 WP_000381183.1 NZ_AP024554:280180-280464 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
Download Length: 285 bp
>AT38680 NZ_AP024554:280180-280464 [Vibrio cholerae]
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9K2M8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A067BL33 |