Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 326198..326738 | Replicon | chromosome |
Accession | NZ_CP024163 | ||
Organism | Vibrio cholerae strain E7946 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | CSW01_RS15670 | Protein ID | WP_000277238.1 |
Coordinates | 326198..326467 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | CSW01_RS15675 | Protein ID | WP_001258569.1 |
Coordinates | 326460..326738 (-) | Length | 93 a.a. |
Genomic Context
Location: 321688..322074 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 322131..322244 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 322193..322474 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 322732..323268 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 323405..323920 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 325229..325354 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 325370..325408 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 325604..326050 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 327024..327302 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 327554..327760 (207 bp)
Type: Others
Protein ID: Protein_289
Type: Others
Protein ID: Protein_289
Location: 327960..328061 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 328051..328437 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 328632..328883 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 328856..329005 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 329097..329339 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 329591..329869 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 330244..330387 (144 bp)
Type: Others
Protein ID: Protein_296
Type: Others
Protein ID: Protein_296
Location: 330441..330479 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 330691..331158 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 321202..321444 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 324070..324567 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 324564..324836 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 326198..326467 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 326460..326738 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSW01_RS15590 | 321202..321444 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
CSW01_RS15595 | 321688..322074 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
CSW01_RS15600 | 322131..322244 | + | 114 | WP_001900214.1 | hypothetical protein | - |
CSW01_RS15605 | 322193..322474 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
CSW01_RS15620 | 322732..323268 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
CSW01_RS15625 | 323405..323920 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
CSW01_RS15635 | 324070..324567 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
CSW01_RS15640 | 324564..324836 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
CSW01_RS15650 | 325229..325354 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
CSW01_RS19800 | 325370..325408 | + | 39 | WP_106019118.1 | hypothetical protein | - |
CSW01_RS15660 | 325604..326050 | + | 447 | WP_000006157.1 | hypothetical protein | - |
CSW01_RS15670 | 326198..326467 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
CSW01_RS15675 | 326460..326738 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
CSW01_RS15685 | 327024..327302 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
CSW01_RS19805 | 327554..327760 | + | 207 | Protein_289 | DUF3709 domain-containing protein | - |
CSW01_RS15690 | 327960..328061 | + | 102 | WP_001921603.1 | hypothetical protein | - |
CSW01_RS15695 | 328051..328437 | + | 387 | WP_000703163.1 | VOC family protein | - |
CSW01_RS15700 | 328632..328883 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
CSW01_RS15705 | 328856..329005 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
CSW01_RS15710 | 329097..329339 | + | 243 | WP_000107461.1 | hypothetical protein | - |
CSW01_RS15715 | 329591..329869 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
CSW01_RS19945 | 330244..330387 | + | 144 | Protein_296 | DUF645 family protein | - |
CSW01_RS19950 | 330441..330479 | + | 39 | WP_082798268.1 | hypothetical protein | - |
CSW01_RS15740 | 330691..331158 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304226..433944 | 129718 | |
inside | Integron | - | - | 309306..433568 | 124262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T87018 WP_000277238.1 NZ_CP024163:c326467-326198 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T87018 NZ_CP024163:c326467-326198 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT87018 WP_001258569.1 NZ_CP024163:c326738-326460 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT87018 NZ_CP024163:c326738-326460 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |