Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 394560..395088 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag DG176_RS16175 Protein ID WP_000221354.1
Coordinates 394560..394847 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0X1KZS8
Locus tag DG176_RS16180 Protein ID WP_001250179.1
Coordinates 394837..395088 (-) Length 84 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS16125 389663..390196 - 534 WP_000118351.1 GNAT family N-acetyltransferase -
DG176_RS16130 390193..390618 - 426 WP_001882332.1 DUF1778 domain-containing protein -
DG176_RS16135 390685..391056 - 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG176_RS16140 391197..391484 - 288 WP_000426470.1 hypothetical protein -
DG176_RS16145 391636..392304 - 669 WP_000043871.1 hypothetical protein -
DG176_RS16150 392535..392807 + 273 WP_000246253.1 DUF1778 domain-containing protein -
DG176_RS16155 392804..393301 + 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG176_RS16165 393503..393655 - 153 WP_001884520.1 DUF645 family protein -
DG176_RS16170 393977..394432 - 456 WP_001245327.1 GNAT family N-acetyltransferase -
DG176_RS16175 394560..394847 - 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG176_RS16180 394837..395088 - 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG176_RS16185 395302..395715 - 414 WP_000049417.1 VOC family protein -
DG176_RS16190 395790..395933 - 144 WP_071908341.1 DUF3265 domain-containing protein -
DG176_RS16195 395903..396304 - 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
DG176_RS16200 396304..396996 - 693 WP_001047169.1 GNAT family N-acetyltransferase -
DG176_RS16205 397133..397439 - 307 Protein_349 CatB-related O-acetyltransferase -
DG176_RS16210 397507..398487 + 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
DG176_RS19665 398612..398767 - 156 WP_000751734.1 hypothetical protein -
DG176_RS16215 398935..399369 - 435 WP_000256036.1 GNAT family N-acetyltransferase -
DG176_RS16220 399506..399820 - 315 WP_000071008.1 DNA-binding transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
flank IS/Tn - - 397507..398487 980
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T294374 WP_000221354.1 NZ_LT992489:c394847-394560 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp


Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.29 Da        Isoelectric Point: 4.0197

>AT294374 WP_001250179.1 NZ_LT992489:c395088-394837 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6


Antitoxin

Source ID Structure
AlphaFold DB A0A0X1KZS8

References