Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 370414..371029 | Replicon | chromosome |
Accession | NZ_CP047304 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain E7946 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | GTF74_RS15605 | Protein ID | WP_001162670.1 |
Coordinates | 370414..370701 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | GTF74_RS15610 | Protein ID | WP_001232701.1 |
Coordinates | 370712..371029 (+) | Length | 106 a.a. |
Genomic Context
Location: 366050..366145 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 367159..367668 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 367725..368378 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 368688..368906 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 369309..369542 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 369967..370147 (181 bp)
Type: Others
Protein ID: Protein_366
Type: Others
Protein ID: Protein_366
Location: 370414..370701 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1
Type: Toxin
Protein ID: WP_001162670.1
Location: 370712..371029 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1
Type: Antitoxin
Protein ID: WP_001232701.1
Location: 371026..371136 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 371313..371438 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 371454..371492 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 371716..372456 (741 bp)
Type: Others
Protein ID: WP_000469836.1
Type: Others
Protein ID: WP_000469836.1
Location: 372661..373491 (831 bp)
Type: Others
Protein ID: WP_000056616.1
Type: Others
Protein ID: WP_000056616.1
Location: 373548..374030 (483 bp)
Type: Others
Protein ID: WP_001895003.1
Type: Others
Protein ID: WP_001895003.1
Location: 374477..375352 (876 bp)
Type: Others
Protein ID: WP_000259044.1
Type: Others
Protein ID: WP_000259044.1
Location: 375482..375937 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 366339..366656 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 366675..366917 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF74_RS15565 | 366050..366145 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
GTF74_RS15570 | 366339..366656 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GTF74_RS15575 | 366675..366917 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF74_RS15580 | 367159..367668 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
GTF74_RS15585 | 367725..368378 | + | 654 | WP_000226874.1 | hypothetical protein | - |
GTF74_RS15590 | 368688..368906 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
GTF74_RS15595 | 369309..369542 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
GTF74_RS15600 | 369967..370147 | + | 181 | Protein_366 | DUF645 family protein | - |
GTF74_RS15605 | 370414..370701 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF74_RS15610 | 370712..371029 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
GTF74_RS15615 | 371026..371136 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
GTF74_RS15620 | 371313..371438 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
GTF74_RS15625 | 371454..371492 | + | 39 | WP_106019119.1 | hypothetical protein | - |
GTF74_RS15630 | 371716..372456 | + | 741 | WP_000469836.1 | PhzF family phenazine biosynthesis protein | - |
GTF74_RS15635 | 372661..373491 | + | 831 | WP_000056616.1 | abortive infection family protein | - |
GTF74_RS15640 | 373548..374030 | + | 483 | WP_001895003.1 | hypothetical protein | - |
GTF74_RS15645 | 374477..375352 | + | 876 | WP_000259044.1 | hypothetical protein | - |
GTF74_RS15650 | 375482..375937 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 307032..436751 | 129719 | |
inside | Integron | - | - | 312112..436375 | 124263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T145890 WP_001162670.1 NZ_CP047304:370414-370701 [Vibrio cholerae O1 biovar El Tor]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T145890 NZ_CP062706:71588-71746 [Escherichia coli O157:H7]
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATAGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATAGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT145890 WP_001232701.1 NZ_CP047304:370712-371029 [Vibrio cholerae O1 biovar El Tor]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
>AT145890 NZ_CP062706:71325-71523 [Escherichia coli O157:H7]
TCACACGGATTGCCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAATGTGGTCAGCGTGCTGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACGGATTGCCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAATGTGGTCAGCGTGCTGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F2HI36 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |