Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 328873..329413 | Replicon | chromosome |
Accession | NZ_CP047298 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain C6709 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | GTF73_RS15240 | Protein ID | WP_000277238.1 |
Coordinates | 328873..329142 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | GTF73_RS15245 | Protein ID | WP_001258569.1 |
Coordinates | 329135..329413 (-) | Length | 93 a.a. |
Genomic Context
Location: 324363..324749 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 324806..324919 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 324868..325149 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 325407..325943 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 326080..326595 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 327904..328029 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 328045..328083 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 328279..328725 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 329699..329977 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 330229..330435 (207 bp)
Type: Others
Protein ID: Protein_294
Type: Others
Protein ID: Protein_294
Location: 330635..330736 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 330726..331112 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 331307..331558 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 331531..331680 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 331772..332014 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 332266..332544 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 332919..333062 (144 bp)
Type: Others
Protein ID: Protein_301
Type: Others
Protein ID: Protein_301
Location: 333116..333154 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 333366..333833 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 323877..324119 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 325125..325283 (159 bp)
Type: Others
Protein ID: WP_001886450.1
Type: Others
Protein ID: WP_001886450.1
Location: 326745..327242 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 327239..327511 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 328873..329142 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 329135..329413 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF73_RS15180 | 323877..324119 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF73_RS15185 | 324363..324749 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
GTF73_RS15190 | 324806..324919 | + | 114 | WP_001900214.1 | hypothetical protein | - |
GTF73_RS15195 | 324868..325149 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
GTF73_RS15200 | 325125..325283 | - | 159 | WP_001886450.1 | DUF1196 family protein | - |
GTF73_RS15205 | 325407..325943 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
GTF73_RS15210 | 326080..326595 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
GTF73_RS15215 | 326745..327242 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GTF73_RS15220 | 327239..327511 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GTF73_RS15225 | 327904..328029 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
GTF73_RS15230 | 328045..328083 | + | 39 | WP_106019118.1 | hypothetical protein | - |
GTF73_RS15235 | 328279..328725 | + | 447 | WP_000006157.1 | hypothetical protein | - |
GTF73_RS15240 | 328873..329142 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
GTF73_RS15245 | 329135..329413 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
GTF73_RS15250 | 329699..329977 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
GTF73_RS15255 | 330229..330435 | + | 207 | Protein_294 | DUF3709 domain-containing protein | - |
GTF73_RS15260 | 330635..330736 | + | 102 | WP_001921603.1 | hypothetical protein | - |
GTF73_RS15265 | 330726..331112 | + | 387 | WP_000703163.1 | VOC family protein | - |
GTF73_RS15270 | 331307..331558 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
GTF73_RS15275 | 331531..331680 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
GTF73_RS15280 | 331772..332014 | + | 243 | WP_000107461.1 | hypothetical protein | - |
GTF73_RS15285 | 332266..332544 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
GTF73_RS15290 | 332919..333062 | + | 144 | Protein_301 | DUF645 family protein | - |
GTF73_RS15295 | 333116..333154 | + | 39 | WP_082798268.1 | hypothetical protein | - |
GTF73_RS15300 | 333366..333833 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306901..436162 | 129261 | |
inside | Integron | - | - | 311981..435786 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T145825 WP_000277238.1 NZ_CP047298:c329142-328873 [Vibrio cholerae O1 biovar El Tor]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T145825 NZ_CP062700:4802031-4802372 [Escherichia coli O157:H7]
ATGACTGATACGCATTCTATTGCACAACCGTTCGAAGCAGAAGTCTCCCCGGCAAATAACCGTCAATTAACCGTGAGTTA
TGCGAGTCGTTACCCGGATTACAGCCGTATTCCCGCCATCACCCTGAAAGGTCAGTGGCTGGAAGCCGCCGGTTTTGCCA
CCGGCACGGTGGTAGATGTCAAAGTGATGGAAGGCTGTATTGTCCTCACCGCCCAACCACCCGCCGCCGCCGAGAGCGAA
CTGATGCAGTCGCTGCGCCAGGTGTGCAAGCTGTCGGCGCGTAAACAAAGGCAGGTGCAGGAGTTTATTGGGGTGATTGC
GGGTAAACAGAAAGTTGCCTGA
ATGACTGATACGCATTCTATTGCACAACCGTTCGAAGCAGAAGTCTCCCCGGCAAATAACCGTCAATTAACCGTGAGTTA
TGCGAGTCGTTACCCGGATTACAGCCGTATTCCCGCCATCACCCTGAAAGGTCAGTGGCTGGAAGCCGCCGGTTTTGCCA
CCGGCACGGTGGTAGATGTCAAAGTGATGGAAGGCTGTATTGTCCTCACCGCCCAACCACCCGCCGCCGCCGAGAGCGAA
CTGATGCAGTCGCTGCGCCAGGTGTGCAAGCTGTCGGCGCGTAAACAAAGGCAGGTGCAGGAGTTTATTGGGGTGATTGC
GGGTAAACAGAAAGTTGCCTGA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT145825 WP_001258569.1 NZ_CP047298:c329413-329135 [Vibrio cholerae O1 biovar El Tor]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT145825 NZ_CP062700:c4802036-4801960 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |