Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 845232..845779 | Replicon | chromosome |
Accession | NZ_CP090400 | ||
Organism | Vibrio cholerae strain PanChol |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | LZM82_RS17290 | Protein ID | WP_000229317.1 |
Coordinates | 845232..845534 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | LZM82_RS17295 | Protein ID | WP_000861987.1 |
Coordinates | 845522..845779 (-) | Length | 86 a.a. |
Genomic Context
Location: 848853..849125 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 849122..849619 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 840431..840499 (69 bp)
Type: Others
Protein ID: Protein_717
Type: Others
Protein ID: Protein_717
Location: 840556..841155 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 841305..842177 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 842352..842573 (222 bp)
Type: Others
Protein ID: Protein_720
Type: Others
Protein ID: Protein_720
Location: 842634..843071 (438 bp)
Type: Others
Protein ID: WP_000503164.1
Type: Others
Protein ID: WP_000503164.1
Location: 843190..843399 (210 bp)
Type: Others
Protein ID: Protein_722
Type: Others
Protein ID: Protein_722
Location: 843535..843924 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 844081..844998 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 845232..845534 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 845522..845779 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 845861..845971 (111 bp)
Type: Others
Protein ID: WP_086010065.1
Type: Others
Protein ID: WP_086010065.1
Location: 845981..846514 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 846511..846780 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 847003..847374 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 847515..847802 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 847954..848622 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 848639..848701 (63 bp)
Type: Others
Protein ID: Protein_733
Type: Others
Protein ID: Protein_733
Location: 849636..849704 (69 bp)
Type: Others
Protein ID: Protein_736
Type: Others
Protein ID: Protein_736
Location: 849821..849925 (105 bp)
Type: Others
Protein ID: WP_228840819.1
Type: Others
Protein ID: WP_228840819.1
Location: 850116..850238 (123 bp)
Type: Others
Protein ID: Protein_738
Type: Others
Protein ID: Protein_738
Location: 850295..850750 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LZM82_RS17250 (LZM82_17250) | 840431..840499 | - | 69 | Protein_717 | acetyltransferase | - |
LZM82_RS17255 (LZM82_17255) | 840556..841155 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
LZM82_RS17260 (LZM82_17260) | 841305..842177 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
LZM82_RS17265 (LZM82_17265) | 842352..842573 | - | 222 | Protein_720 | GNAT family N-acetyltransferase | - |
LZM82_RS17270 (LZM82_17270) | 842634..843071 | - | 438 | WP_000503164.1 | IS200/IS605-like element IS1004 family transposase | - |
LZM82_RS17275 (LZM82_17275) | 843190..843399 | - | 210 | Protein_722 | GNAT family N-acetyltransferase | - |
LZM82_RS17280 (LZM82_17280) | 843535..843924 | - | 390 | WP_001081302.1 | hypothetical protein | - |
LZM82_RS17285 (LZM82_17285) | 844081..844998 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
LZM82_RS17290 (LZM82_17290) | 845232..845534 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LZM82_RS17295 (LZM82_17295) | 845522..845779 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
LZM82_RS17300 (LZM82_17300) | 845861..845971 | - | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
LZM82_RS17305 (LZM82_17305) | 845981..846514 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
LZM82_RS17310 (LZM82_17310) | 846511..846780 | - | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
LZM82_RS17315 (LZM82_17315) | 847003..847374 | - | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
LZM82_RS17320 (LZM82_17320) | 847515..847802 | - | 288 | WP_000426470.1 | hypothetical protein | - |
LZM82_RS17325 (LZM82_17325) | 847954..848622 | - | 669 | WP_000043871.1 | hypothetical protein | - |
LZM82_RS17330 (LZM82_17330) | 848639..848701 | - | 63 | Protein_733 | acetyltransferase | - |
LZM82_RS17335 (LZM82_17335) | 848853..849125 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
LZM82_RS17340 (LZM82_17340) | 849122..849619 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
LZM82_RS17345 (LZM82_17345) | 849636..849704 | - | 69 | Protein_736 | acetyltransferase | - |
LZM82_RS17350 (LZM82_17350) | 849821..849925 | - | 105 | WP_228840819.1 | DUF645 family protein | - |
LZM82_RS17360 (LZM82_17360) | 850116..850238 | - | 123 | Protein_738 | acetyltransferase | - |
LZM82_RS17365 (LZM82_17365) | 850295..850750 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 835643..943910 | 108267 | |
inside | Integron | - | - | 836019..937068 | 101049 | ||
flank | IS/Tn | - | - | 842634..843071 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T230637 WP_000229317.1 NZ_CP090400:c845534-845232 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T230637 NZ_CP125220:c4072698-4072414 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGACTTATGAACTGGAATTCGACCCGAGGGCCTTAAAAGAGTGGCATAAGCTGGGCGATACGGTGCAGGCTCAGCTTAA
GAAAAAGTTGGCTGATGTGCTATTGAACCCCAGAATCGACTCTGCCCGTTTAAACGATCTTCCTGACTGCTATAAAATTA
AGCTTAAATCGTCCGGTTATCGCTTGGTGTACCAGGTTCGGGATGACGTTGTGATTGTGTTTGTTGTCGCGGTCGGTAAG
CGAGAACATTCAGCCGTCTATCACGATGCAAACAAACGGCTTTAG
ATGACTTATGAACTGGAATTCGACCCGAGGGCCTTAAAAGAGTGGCATAAGCTGGGCGATACGGTGCAGGCTCAGCTTAA
GAAAAAGTTGGCTGATGTGCTATTGAACCCCAGAATCGACTCTGCCCGTTTAAACGATCTTCCTGACTGCTATAAAATTA
AGCTTAAATCGTCCGGTTATCGCTTGGTGTACCAGGTTCGGGATGACGTTGTGATTGTGTTTGTTGTCGCGGTCGGTAAG
CGAGAACATTCAGCCGTCTATCACGATGCAAACAAACGGCTTTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT230637 WP_000861987.1 NZ_CP090400:c845779-845522 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT230637 NZ_CP125220:c4072930-4072688 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGGCCACGCTGAACGTCCGTCTGGATGACAAACTCAAAAATGAGGCTTATGCCGTGCTGGAAAAACTGAACATTACTCC
AACGGAAGCCGTGCGATTACTGTTCCAGTACGTCGCGGAAACGGGGCGCATGCCAGTGAAAACCGTCACTCTTAGCGACA
GTGAAGATGCATTGATTCAGACAGTTCGGGAGAGGCTGTCTAGTCCGCAAAAGGGAATCAAGGTTAGTCTGGATGACTTA
TGA
ATGGCCACGCTGAACGTCCGTCTGGATGACAAACTCAAAAATGAGGCTTATGCCGTGCTGGAAAAACTGAACATTACTCC
AACGGAAGCCGTGCGATTACTGTTCCAGTACGTCGCGGAAACGGGGCGCATGCCAGTGAAAACCGTCACTCTTAGCGACA
GTGAAGATGCATTGATTCAGACAGTTCGGGAGAGGCTGTCTAGTCCGCAAAAGGGAATCAAGGTTAGTCTGGATGACTTA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |