Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 425625..426172 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name relE Uniprot ID Q9KM92
Locus tag FY484_RS16485 Protein ID WP_000229317.1
Coordinates 425870..426172 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag FY484_RS16480 Protein ID WP_000861987.1
Coordinates 425625..425882 (+) Length 86 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS16425 420654..421109 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
FY484_RS16430 421431..421583 + 153 WP_001884520.1 DUF645 family protein -
FY484_RS16440 421785..422282 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
FY484_RS16445 422279..422551 - 273 WP_000246253.1 DUF1778 domain-containing protein -
FY484_RS16450 422782..423450 + 669 WP_000043871.1 hypothetical protein -
FY484_RS16455 423602..423889 + 288 WP_000426470.1 hypothetical protein -
FY484_RS16460 424030..424401 + 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
FY484_RS19570 424468..424893 + 426 WP_001882332.1 DUF1778 domain-containing protein -
FY484_RS16470 424890..425423 + 534 WP_000118351.1 GNAT family N-acetyltransferase -
FY484_RS16480 425625..425882 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FY484_RS16485 425870..426172 + 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FY484_RS16490 426406..427323 + 918 WP_000186333.1 alpha/beta hydrolase -
FY484_RS16495 427480..427869 + 390 WP_001081302.1 hypothetical protein -
FY484_RS16500 428005..428214 + 210 Protein_466 GNAT family N-acetyltransferase -
FY484_RS16505 428333..428770 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
FY484_RS16510 428834..429052 + 219 WP_071908318.1 GNAT family N-acetyltransferase -
FY484_RS16515 429227..430099 + 873 WP_000254716.1 DUF3800 domain-containing protein -
FY484_RS16520 430249..430848 + 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
FY484_RS16525 430905..431009 + 105 WP_099607150.1 acetyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639
flank IS/Tn - - 428333..428770 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 101 a.a.        Molecular weight: 11726.68 Da        Isoelectric Point: 5.1972

>T293806 WP_000229317.1 NZ_LT906615:425870-426172 [Vibrio cholerae O1 biovar El Tor str. N16961]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp


Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT293806 WP_000861987.1 NZ_LT906615:425625-425882 [Vibrio cholerae O1 biovar El Tor str. N16961]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB Q9KM92


Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References