294377

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 415269..415797 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag DG176_RS16390 Protein ID WP_000221352.1
Coordinates 415507..415797 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H9L4T4
Locus tag DG176_RS16385 Protein ID WP_000213183.1
Coordinates 415269..415517 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS16335 410304..410768 + 465 WP_000140244.1 hypothetical protein -
DG176_RS16340 410868..411270 - 403 Protein_373 hypothetical protein -
DG176_RS16350 411426..411926 - 501 WP_000789723.1 hypothetical protein -
DG176_RS16355 412064..412594 - 531 WP_000415563.1 hypothetical protein -
DG176_RS16360 412745..413140 - 396 WP_000649527.1 DUF3465 domain-containing protein -
DG176_RS16365 413348..413773 - 426 WP_000415748.1 hypothetical protein -
DG176_RS16370 414045..414698 - 654 WP_000036957.1 site-specific DNA-methyltransferase -
DG176_RS16385 415269..415517 + 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG176_RS16390 415507..415797 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG176_RS16395 415933..416448 - 516 WP_001201528.1 lipocalin family protein -
DG176_RS16400 416585..417061 - 477 WP_001047180.1 GNAT family N-acetyltransferase -
DG176_RS16405 417089..417199 - 111 WP_071917832.1 DUF3265 domain-containing protein -
DG176_RS16410 417196..418125 - 930 WP_000335802.1 hypothetical protein -
DG176_RS16415 418245..418691 - 447 WP_000128977.1 hypothetical protein -
DG176_RS16420 418844..419848 - 1005 WP_000964925.1 LD-carboxypeptidase -
DG176_RS19810 420061..420099 - 39 WP_106019119.1 hypothetical protein -
DG176_RS19815 420115..420240 - 126 WP_001944767.1 DUF645 family protein -
DG176_RS19820 420417..420527 - 111 WP_134814058.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T294377 WP_000221352.1 NZ_LT992489:415507-415797 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8937.28 Da        Isoelectric Point: 4.1079

>AT294377 WP_000213183.1 NZ_LT992489:415269-415517 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure
AlphaFold DB A0A366A3W8

References