294358

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 938724..939339 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name higB Uniprot ID Q9KMG5
Locus tag DG247_RS18755 Protein ID WP_001162670.1
Coordinates 939052..939339 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DG247_RS18750 Protein ID WP_001232701.1
Coordinates 938724..939041 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS18700 934133..934648 - 516 WP_001201528.1 lipocalin family protein -
DG247_RS18705 934785..935261 - 477 WP_001047180.1 GNAT family N-acetyltransferase -
DG247_RS18710 935289..935399 - 111 WP_071917832.1 DUF3265 domain-containing protein -
DG247_RS18715 935396..936325 - 930 WP_000335802.1 hypothetical protein -
DG247_RS18720 936445..936891 - 447 WP_000128977.1 hypothetical protein -
DG247_RS18725 937044..938048 - 1005 WP_000964925.1 LD-carboxypeptidase -
DG247_RS19820 938261..938299 - 39 WP_106019119.1 hypothetical protein -
DG247_RS19825 938315..938440 - 126 WP_001944767.1 DUF645 family protein -
DG247_RS19830 938617..938727 - 111 WP_134814058.1 DUF3265 domain-containing protein -
DG247_RS18750 938724..939041 - 318 WP_001232701.1 HigA family addiction module antidote protein Antitoxin
DG247_RS18755 939052..939339 - 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG247_RS18760 939606..939786 - 181 Protein_830 DUF645 family protein -
DG247_RS18765 940211..940444 - 234 WP_032482776.1 DUF3709 domain-containing protein -
DG247_RS18770 940847..941065 - 219 WP_001917086.1 DUF3709 domain-containing protein -
DG247_RS18775 941375..942028 - 654 WP_000226874.1 hypothetical protein -
DG247_RS18780 942085..942594 - 510 WP_000405987.1 GNAT family N-acetyltransferase -
DG247_RS18785 942836..943078 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG247_RS18790 943097..943414 + 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG247_RS19835 943608..943703 - 96 WP_001907607.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(2-95)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-69)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11349.95 Da        Isoelectric Point: 6.7187

>T294358 WP_001162670.1 NZ_LT992487:c939339-939052 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY

Download         Length: 288 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11705.63 Da        Isoelectric Point: 10.4711

>AT294358 WP_001232701.1 NZ_LT992487:c939041-938724 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0F2HI36

Antitoxin

Source ID Structure

References