Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 1027271..1027769 | Replicon | chromosome |
Accession | NC_012667 | ||
Organism | Vibrio cholerae MJ-1236 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | VCD_RS19435 | Protein ID | WP_000589156.1 |
Coordinates | 1027503..1027769 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | VCD_RS19430 | Protein ID | WP_000643598.1 |
Coordinates | 1027271..1027516 (-) | Length | 82 a.a. |
Genomic Context
Location: 1022352..1022738 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 1022895..1023401 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 1023669..1023902 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 1024175..1024534 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 1024687..1025691 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 1025907..1026089 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 1026150..1026278 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 1026381..1027175 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 1027271..1027516 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 1027503..1027769 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 1027954..1028616 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 1028744..1029211 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 1029423..1029461 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 1029515..1029658 (144 bp)
Type: Others
Protein ID: Protein_956
Type: Others
Protein ID: Protein_956
Location: 1030033..1030311 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 1030563..1030805 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 1030897..1031046 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 1031019..1031270 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 1031465..1031851 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 1031841..1031942 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 1032142..1032348 (207 bp)
Type: Others
Protein ID: Protein_963
Type: Others
Protein ID: Protein_963
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCD_RS19395 | 1022352..1022738 | - | 387 | WP_000703163.1 | VOC family protein | - |
VCD_RS19400 | 1022895..1023401 | - | 507 | WP_000393074.1 | hypothetical protein | - |
VCD_RS19405 | 1023669..1023902 | - | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
VCD_RS19410 | 1024175..1024534 | - | 360 | WP_001071541.1 | VOC family protein | - |
VCD_RS19415 | 1024687..1025691 | - | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
VCD_RS19420 | 1025907..1026089 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
VCD_RS21085 | 1026150..1026278 | - | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
VCD_RS19425 | 1026381..1027175 | - | 795 | WP_001911581.1 | hypothetical protein | - |
VCD_RS19430 | 1027271..1027516 | - | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
VCD_RS19435 | 1027503..1027769 | - | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
VCD_RS19440 | 1027954..1028616 | - | 663 | WP_000960654.1 | hypothetical protein | - |
VCD_RS19445 | 1028744..1029211 | - | 468 | WP_001289288.1 | OsmC family protein | - |
VCD_RS21090 | 1029423..1029461 | - | 39 | WP_082798268.1 | hypothetical protein | - |
VCD_RS21095 | 1029515..1029658 | - | 144 | Protein_956 | DUF645 family protein | - |
VCD_RS19455 | 1030033..1030311 | - | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
VCD_RS19460 | 1030563..1030805 | - | 243 | WP_000107461.1 | hypothetical protein | - |
VCD_RS20550 | 1030897..1031046 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
VCD_RS19465 | 1031019..1031270 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
VCD_RS19470 | 1031465..1031851 | - | 387 | WP_000703163.1 | VOC family protein | - |
VCD_RS20935 | 1031841..1031942 | - | 102 | WP_001921603.1 | hypothetical protein | - |
VCD_RS20940 | 1032142..1032348 | - | 207 | Protein_963 | DUF3709 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 932253..1057432 | 125179 | |
inside | Integron | - | - | 958376..1050596 | 92220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T23792 WP_000589156.1 NC_012667:c1027769-1027503 [Vibrio cholerae MJ-1236]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T23792 NC_012667:c1027769-1027503 [Vibrio cholerae MJ-1236]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT23792 WP_000643598.1 NC_012667:c1027516-1027271 [Vibrio cholerae MJ-1236]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT23792 NC_012667:c1027516-1027271 [Vibrio cholerae MJ-1236]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |