Detailed information of TA system TA145874

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): phd-doc/Doc-GNAT
• Location: 393465..394558
• Replicon: chromosome
• Accession: NZ_CP047302
• Organism: Vibrio cholerae O1 biovar El Tor strain DRC-193A

Toxin (Protein)

• Gene name: doc
• Uniprot ID: Q9KMA2
• Locus tag: GTF75_RS15965
• Protein ID: WP_000351248.1
• Coordinates: 394157..394558 (+)
• Length: 134 a.a.

Antitoxin (Protein)

• Gene name: phd
• Uniprot ID: -
• Locus tag: GTF75_RS15960
• Protein ID: WP_001047169.1
• Coordinates: 393465..394157 (+)
• Length: 231 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
GTF75_RS15900	388748..389125	+	378	WP_000411109.1	hypothetical protein	-
GTF75_RS15905	389305..389526	+	222	WP_032468461.1	DUF1289 domain-containing protein	-
GTF75_RS15910	389502..389660	-	159	WP_001894455.1	DUF1196 family protein	-
GTF75_RS15915	389692..389805	+	114	WP_001889158.1	hypothetical protein	-
GTF75_RS15920	389754..389981	+	228	WP_001894457.1	DUF1289 domain-containing protein	-
GTF75_RS15925	390011..390169	-	159	WP_001882309.1	DUF1196 family protein	-
GTF75_RS15930	390322..390654	+	333	WP_000843587.1	type II toxin-antitoxin system RelE/ParE family toxin	-
GTF75_RS15935	390641..390955	+	315	WP_000071008.1	DNA-binding transcriptional regulator	-
GTF75_RS15940	391092..391526	+	435	WP_000256036.1	GNAT family N-acetyltransferase	-
GTF75_RS15945	391694..391849	+	156	WP_000751734.1	hypothetical protein	-
GTF75_RS15950	391974..392954	-	981	WP_000019370.1	IS5-like element ISVch5 family transposase	-
GTF75_RS15955	393022..393294	+	273	Protein_410	CatB-related O-acetyltransferase	-
GTF75_RS15960	393465..394157	+	693	WP_001047169.1	GNAT family N-acetyltransferase	Antitoxin
GTF75_RS15965	394157..394558	+	402	WP_000351248.1	type II toxin-antitoxin system death-on-curing family toxin	Toxin
GTF75_RS15970	394528..394671	+	144	WP_071908341.1	DUF3265 domain-containing protein	-
GTF75_RS15975	394746..395159	+	414	WP_000049417.1	VOC family protein	-
GTF75_RS15980	395373..395624	+	252	WP_001250179.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
GTF75_RS15985	395614..395901	+	288	WP_000221354.1	type II toxin-antitoxin system RelE/ParE family toxin	-
GTF75_RS15990	396029..396484	+	456	WP_001245327.1	GNAT family N-acetyltransferase	-
GTF75_RS15995	396806..396958	+	153	WP_001884520.1	DUF645 family protein	-
GTF75_RS16000	397160..397657	-	498	WP_000982260.1	GNAT family N-acetyltransferase	-
GTF75_RS16005	397654..397926	-	273	WP_000246253.1	DUF1778 domain-containing protein	-
GTF75_RS16010	398157..398825	+	669	WP_000043871.1	hypothetical protein	-
GTF75_RS16015	398977..399264	+	288	WP_000426470.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	305935..411136	105201
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0.004	inside	Integron	-	-	311015..410760	99745
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA000174, TA000175, TA000176, TA010030 416601..417581 0	flank	IS/Tn	-	-	391974..392954	980

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Death on curing protein (1-132)

Antitoxin

• GNAT domain (36-153)

Sequences

Toxin

Protein

• Length: 134 a.a.
• Molecular weight: 14608.71 Da
• Isoelectric Point: 4.0128

>T145874 WP_000351248.1 NZ_CP047302:394157-394558 [Vibrio cholerae O1 biovar El Tor]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Nucleotide

• Length: 402 bp

>T145874 NZ_CP062705:3066565-3066843 [Escherichia coli O157:H7]
ATGTTACCCGTGTTATGGCTTGAAAGCGCAGATACCGACCTAGATGATATAACTAGTTATATTGCTCGTTTCGACATAGA
TGCGGCTGAACGCTTATGGCAGCGATTAAGGGGTTGTGTGCTGCCGTTATCCGAACATCCGTATTTATACCCACCAAGCG
ACAGAGTACCTGGCTTGCGTGAGATTGTAGCCCACCCTAACTATATAATTCTATACCGCGTAACAACATCAAGCGTTGAA
GTAGTAAACGTGATCCACGCAAGACGCCAGTTTCCCTAA

Antitoxin

Protein

• Length: 231 a.a.
• Molecular weight: 26352.73 Da
• Isoelectric Point: 8.5633

>AT145874 WP_001047169.1 NZ_CP047302:393465-394157 [Vibrio cholerae O1 biovar El Tor]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Nucleotide

• Length: 693 bp

>AT145874 NZ_CP062705:3066372-3066563 [Escherichia coli O157:H7]
ATGAATAGAGCCCTTTCACCAATGGTTTCTGAATTTGAAACCATTGAACAAGAAAACAGTTACAACGAATGGCTGCGTGC
GAAAGTAGCAACGAGCCTTGCAGATCCGCGCCCAGCAATTCCCCATGACGAAGTTGAGCGCAGAATGGCAGAACGCTTTG
CTAAGATGCGCAAGGAACGGAGCAAGCAGTAA

Structures

Toxin

• AlphaFold DB: A0A0Q0PN34