Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 917706..918339 | Replicon | chromosome |
| Accession | NZ_LT992487 | ||
| Organism | Vibrio cholerae strain 4295STDY6534216 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q9KMA6 |
| Locus tag | DG247_RS18530 | Protein ID | WP_000843587.1 |
| Coordinates | 918007..918339 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DG247_RS18525 | Protein ID | WP_000071008.1 |
| Coordinates | 917706..918020 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG247_RS18480 | 912760..913047 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG247_RS18485 | 913037..913288 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| DG247_RS18490 | 913502..913915 | - | 414 | WP_000049417.1 | VOC family protein | - |
| DG247_RS18495 | 913990..914133 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
| DG247_RS18500 | 914103..914504 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| DG247_RS18505 | 914504..915196 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
| DG247_RS18510 | 915333..915639 | - | 307 | Protein_787 | CatB-related O-acetyltransferase | - |
| DG247_RS18515 | 915707..916687 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
| DG247_RS19670 | 916812..916967 | - | 156 | WP_000751734.1 | hypothetical protein | - |
| DG247_RS18520 | 917135..917569 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
| DG247_RS18525 | 917706..918020 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
| DG247_RS18530 | 918007..918339 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DG247_RS18540 | 918680..918907 | - | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
| DG247_RS19800 | 918856..918969 | - | 114 | WP_001889158.1 | hypothetical protein | - |
| DG247_RS18560 | 919135..919416 | - | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
| DG247_RS19805 | 919365..919479 | - | 115 | Protein_796 | acetyltransferase | - |
| DG247_RS18565 | 919536..919913 | - | 378 | WP_000411109.1 | hypothetical protein | - |
| DG247_RS18570 | 920084..920326 | - | 243 | WP_000107461.1 | hypothetical protein | - |
| DG247_RS18575 | 920528..920914 | - | 387 | WP_000703163.1 | VOC family protein | - |
| DG247_RS19870 | 921123..921294 | - | 172 | Protein_800 | DUF645 family protein | - |
| DG247_RS18585 | 921612..921881 | - | 270 | WP_001198131.1 | hypothetical protein | - |
| DG247_RS18590 | 922241..922414 | - | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
| DG247_RS19725 | 922695..922898 | - | 204 | WP_001911745.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
| inside | Integron | catB9 | - | 897901..987709 | 89808 | ||
| flank | IS/Tn | - | - | 915707..916687 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T294356 WP_000843587.1 NZ_LT992487:c918339-918007 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|