Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 369423..370038 | Replicon | chromosome |
Accession | NZ_LT906615 | ||
Organism | Vibrio cholerae O1 biovar El Tor str. N16961 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | FY484_RS15865 | Protein ID | WP_001162670.1 |
Coordinates | 369423..369710 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FY484_RS15870 | Protein ID | WP_001232701.1 |
Coordinates | 369721..370038 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FY484_RS19515 | 365059..365154 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
FY484_RS15830 | 365348..365665 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FY484_RS15835 | 365684..365926 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FY484_RS15840 | 366168..366677 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
FY484_RS15845 | 366734..367387 | + | 654 | WP_000226874.1 | hypothetical protein | - |
FY484_RS15850 | 367697..367915 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
FY484_RS15855 | 368318..368551 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
FY484_RS15860 | 368976..369156 | + | 181 | Protein_363 | DUF645 family protein | - |
FY484_RS15865 | 369423..369710 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FY484_RS15870 | 369721..370038 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
FY484_RS19520 | 370035..370145 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
FY484_RS15885 | 370322..370447 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
FY484_RS15890 | 370463..370501 | + | 39 | WP_106019119.1 | hypothetical protein | - |
FY484_RS15895 | 370725..371465 | + | 741 | WP_000469836.1 | PhzF family phenazine biosynthesis protein | - |
FY484_RS15900 | 371670..372500 | + | 831 | WP_000056616.1 | abortive infection family protein | - |
FY484_RS15905 | 372557..373039 | + | 483 | WP_001895003.1 | hypothetical protein | - |
FY484_RS15915 | 373486..374361 | + | 876 | WP_000259044.1 | hypothetical protein | - |
FY484_RS15920 | 374491..374946 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T293799 WP_001162670.1 NZ_LT906615:369423-369710 [Vibrio cholerae O1 biovar El Tor str. N16961]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT293799 WP_001232701.1 NZ_LT906615:369721-370038 [Vibrio cholerae O1 biovar El Tor str. N16961]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|