Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-GNAT |
Location | 418090..419183 | Replicon | chromosome |
Accession | NZ_LT907990 | ||
Organism | Vibrio cholerae strain A19 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | ALC86_RS16425 | Protein ID | WP_000351248.1 |
Coordinates | 418782..419183 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | ALC86_RS16420 | Protein ID | WP_001047169.1 |
Coordinates | 418090..418782 (+) | Length | 231 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ALC86_RS16350 | 413373..413750 | + | 378 | WP_000411109.1 | hypothetical protein | - |
ALC86_RS19775 | 413807..413921 | + | 115 | Protein_437 | acetyltransferase | - |
ALC86_RS16355 | 413870..414151 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
ALC86_RS16370 | 414317..414430 | + | 114 | WP_001889158.1 | hypothetical protein | - |
ALC86_RS16375 | 414379..414606 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
ALC86_RS16390 | 414947..415279 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ALC86_RS16395 | 415266..415580 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
ALC86_RS16400 | 415717..416151 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
ALC86_RS19610 | 416319..416474 | + | 156 | WP_000751734.1 | hypothetical protein | - |
ALC86_RS16410 | 416599..417579 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
ALC86_RS16415 | 417647..417953 | + | 307 | Protein_446 | CatB-related O-acetyltransferase | - |
ALC86_RS16420 | 418090..418782 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | Antitoxin |
ALC86_RS16425 | 418782..419183 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
ALC86_RS16430 | 419153..419296 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
ALC86_RS16435 | 419371..419784 | + | 414 | WP_000049417.1 | VOC family protein | - |
ALC86_RS16440 | 419998..420249 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ALC86_RS16445 | 420239..420526 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ALC86_RS16450 | 420654..421109 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
ALC86_RS16460 | 421431..421583 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ALC86_RS16470 | 421785..422282 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ALC86_RS16475 | 422279..422551 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ALC86_RS16485 | 422782..423450 | + | 669 | WP_000043871.1 | hypothetical protein | - |
ALC86_RS16490 | 423602..423889 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 | ||
flank | IS/Tn | - | - | 416599..417579 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T293831 WP_000351248.1 NZ_LT907990:418782-419183 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
Antitoxin
Download Length: 231 a.a. Molecular weight: 26352.73 Da Isoelectric Point: 8.5633
>AT293831 WP_001047169.1 NZ_LT907990:418090-418782 [Vibrio cholerae]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 693 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|