Detailed information of TA system TA199001

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /BrnT(toxin)
• Location: 334835..335333
• Replicon: chromosome
• Accession: NZ_CP072850
• Organism: Vibrio cholerae MO10

Toxin (Protein)

• Gene name: -
• Uniprot ID: Q9KMK7
• Locus tag: KAF59_RS15365
• Protein ID: WP_000589156.1
• Coordinates: 334835..335101 (+)
• Length: 89 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: Q9KMK6
• Locus tag: KAF59_RS15370
• Protein ID: WP_000643598.1
• Coordinates: 335088..335333 (+)
• Length: 82 a.a.

Genomic Context

Location: 330364..330462 (99 bp)
Type: Others
Protein ID: WP_223225486.1

Location: 330662..330763 (102 bp)
Type: Others
Protein ID: WP_001921603.1

Location: 330753..331139 (387 bp)
Type: Others
Protein ID: WP_000703163.1

Location: 331334..331585 (252 bp)
Type: Others
Protein ID: WP_001890111.1

Location: 331558..331707 (150 bp)
Type: Others
Protein ID: WP_071908333.1

Location: 331799..332041 (243 bp)
Type: Others
Protein ID: WP_000107461.1

Location: 332293..332571 (279 bp)
Type: Others
Protein ID: WP_000280324.1

Location: 333003..333046 (44 bp)
Type: Others
Protein ID: Protein_302

Location: 333028..333121 (94 bp)
Type: Others
Protein ID: Protein_303

Location: 333090..333221 (132 bp)
Type: Others
Protein ID: WP_001883067.1

Location: 333393..333860 (468 bp)
Type: Others
Protein ID: WP_001289288.1

Location: 333988..334650 (663 bp)
Type: Others
Protein ID: WP_000960654.1

Location: 334640..334768 (129 bp)
Type: Others
Protein ID: WP_088124358.1

Location: 334835..335101 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1

Location: 335088..335333 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1

Location: 335429..336223 (795 bp)
Type: Others
Protein ID: WP_001911581.1

Location: 336220..336336 (117 bp)
Type: Others
Protein ID: WP_086010881.1

Location: 336326..336454 (129 bp)
Type: Others
Protein ID: WP_071908338.1

Location: 336515..336697 (183 bp)
Type: Others
Protein ID: WP_000923182.1

Location: 336897..337370 (474 bp)
Type: Others
Protein ID: WP_001161076.1

Location: 337385..337477 (93 bp)
Type: Others
Protein ID: WP_014378730.1

Location: 337519..338145 (627 bp)
Type: Others
Protein ID: WP_000365424.1

Location: 338268..338966 (699 bp)
Type: Others
Protein ID: WP_001890502.1

Location: 338997..339086 (90 bp)
Type: Others
Protein ID: WP_072606010.1

Location: 339664..339843 (180 bp)
Type: Others
Protein ID: WP_001883058.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KAF59_RS18810	330364..330462	+	99	WP_223225486.1	DUF3709 domain-containing protein	-
KAF59_RS15315 (KAF59_15315)	330662..330763	+	102	WP_001921603.1	hypothetical protein	-
KAF59_RS15320 (KAF59_15320)	330753..331139	+	387	WP_000703163.1	VOC family protein	-
KAF59_RS15325 (KAF59_15325)	331334..331585	+	252	WP_001890111.1	TIGR03643 family protein	-
KAF59_RS15330 (KAF59_15330)	331558..331707	+	150	WP_071908333.1	DUF3265 domain-containing protein	-
KAF59_RS15335 (KAF59_15335)	331799..332041	+	243	WP_000107461.1	hypothetical protein	-
KAF59_RS15340 (KAF59_15340)	332293..332571	+	279	WP_000280324.1	DUF3709 domain-containing protein	-
KAF59_RS18815	333003..333046	+	44	Protein_302	hypothetical protein	-
KAF59_RS18820	333028..333121	+	94	Protein_303	ggdef family protein	-
KAF59_RS18825	333090..333221	+	132	WP_001883067.1	hypothetical protein	-
KAF59_RS15355 (KAF59_15355)	333393..333860	+	468	WP_001289288.1	OsmC family protein	-
KAF59_RS15360 (KAF59_15360)	333988..334650	+	663	WP_000960654.1	hypothetical protein	-
KAF59_RS18830	334640..334768	+	129	WP_088124358.1	DUF3265 domain-containing protein	-
KAF59_RS15365 (KAF59_15365)	334835..335101	+	267	WP_000589156.1	BrnT family toxin	Toxin
KAF59_RS15370 (KAF59_15370)	335088..335333	+	246	WP_000643598.1	hypothetical protein	Antitoxin
KAF59_RS15375 (KAF59_15375)	335429..336223	+	795	WP_001911581.1	hypothetical protein	-
KAF59_RS18835	336220..336336	+	117	WP_086010881.1	DUF3265 domain-containing protein	-
KAF59_RS15380 (KAF59_15380)	336326..336454	+	129	WP_071908338.1	general secretion pathway protein GspI	-
KAF59_RS15385 (KAF59_15385)	336515..336697	+	183	WP_000923182.1	DUF645 family protein	-
KAF59_RS15390 (KAF59_15390)	336897..337370	+	474	WP_001161076.1	GrpB family protein	-
KAF59_RS15395 (KAF59_15395)	337385..337477	+	93	WP_014378730.1	DUF3265 domain-containing protein	-
KAF59_RS15400 (KAF59_15400)	337519..338145	+	627	WP_000365424.1	LysE family translocator	-
KAF59_RS15405 (KAF59_15405)	338268..338966	+	699	WP_001890502.1	hypothetical protein	-
KAF59_RS15410 (KAF59_15410)	338997..339086	+	90	WP_072606010.1	DUF3265 domain-containing protein	-
KAF59_RS15415 (KAF59_15415)	339664..339843	+	180	WP_001883058.1	DUF645 family protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	306928..402189	95261
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0.005	inside	Integron	catB9	-	312008..401813	89805

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (6-81)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 89 a.a.
• Molecular weight: 10092.34 Da
• Isoelectric Point: 7.3171

>T199001 WP_000589156.1 NZ_CP072850:334835-335101 [Vibrio cholerae MO10]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Nucleotide

• Length: 267 bp

>T199001 NZ_CP097083:87269-87739 [Klebsiella pneumoniae]
GTGATCCTCTACAGGCTGACGAAAACAAAGTATCTTTCTACGGCCTGGACCGGATATGGTGCGAAAGAGGCTGGTGGGCG
TTGGAATAGCGTGGGGGTGTCAATGGTATATGTCTCCGAAACGGCATCACTAACGATGCTGGAGACGCTGGTACACCTGC
ATGCGGCACAGATAATGGACTCTTTCACGCTACTGAGTATCGATGTGCCTGATGAACTGATCCAAAGCGCAAACATGGAT
GAATTACCGGGCAACTGGGCTGATGAGGATGCGCCTCAGGAACTGGCTGATTACGGAGATGCCTGGTCATTTACCAGGAG
CTCGGTTGCACTGCGTGTTCCCTCAGCCTTATCGCCGGTAGAGTTCAACTATCTGTTAAATCCTGAGCACCCTGAGTTTT
ACGGGATCGTGCAGAAGGCTCAACAGATACCGTTCCGGTTTGATAGTCGTCTTAAACCTGACAGGAAGTGA

Antitoxin

Protein

• Length: 82 a.a.
• Molecular weight: 9478.77 Da
• Isoelectric Point: 6.4832

>AT199001 WP_000643598.1 NZ_CP072850:335088-335333 [Vibrio cholerae MO10]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Nucleotide

• Length: 246 bp

>AT199001 NZ_CP097083:86829-87272 [Klebsiella pneumoniae]
ATGAAAACATTTAGTTTGTCCTCAACTCCAGCCAGACCACAGCGCCTCTGGCAGGTTGCCGGGTTAAATAATGCTGATGG
CGTAGCGCTTCTGGGCCAAATCAATGAAGGCCTGGACGGGAAGGTGGCGAATCGGATCACTGACTGGGCCAGAATAACCC
AGAATGACCTGAGAAAAATGTCCGGTATCCCGTCGACCACGTTTAGCCGCAGTGTGAAGGCACGTTTTAACCCGGAACAA
AGTGAACGTCTGGTACGGATTATCCGCGTCATTGATCGGGCGGTAGATTTGTTTGAAGGCGACAAGGAAGCCGCACAGAA
GTGGTTGAACGAACCTAACCGGGCATTGAGCTGGAAAGTGCCAGCAGACCTGATGGCATCCGAGACAGGAGCGTATGAGG
TCATTAAGCTGATTACGCGTCTGGAGCATGGGGTGTACTCGTGA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A271VMP7

Antitoxin

Loading, please wait

• AlphaFold DB: A0A271VME2