Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 374668..375196 | Replicon | chromosome |
Accession | NZ_CP047302 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain DRC-193A |
Toxin (Protein)
Gene name | relE | Uniprot ID | H9L4R3 |
Locus tag | GTF75_RS15790 | Protein ID | WP_000221352.1 |
Coordinates | 374668..374958 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | H9L4T4 |
Locus tag | GTF75_RS15795 | Protein ID | WP_000213183.1 |
Coordinates | 374948..375196 (-) | Length | 83 a.a. |
Genomic Context
Location: 369938..370048 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 370225..370350 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 370366..370404 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 370617..371621 (1005 bp)
Type: Others
Protein ID: WP_000964925.1
Type: Others
Protein ID: WP_000964925.1
Location: 371774..372220 (447 bp)
Type: Others
Protein ID: WP_000128977.1
Type: Others
Protein ID: WP_000128977.1
Location: 372340..373269 (930 bp)
Type: Others
Protein ID: WP_000335802.1
Type: Others
Protein ID: WP_000335802.1
Location: 373266..373376 (111 bp)
Type: Others
Protein ID: WP_071917832.1
Type: Others
Protein ID: WP_071917832.1
Location: 373404..373880 (477 bp)
Type: Others
Protein ID: WP_001047180.1
Type: Others
Protein ID: WP_001047180.1
Location: 374017..374532 (516 bp)
Type: Others
Protein ID: WP_001201528.1
Type: Others
Protein ID: WP_001201528.1
Location: 375767..376420 (654 bp)
Type: Others
Protein ID: WP_000036957.1
Type: Others
Protein ID: WP_000036957.1
Location: 376692..377117 (426 bp)
Type: Others
Protein ID: WP_000415748.1
Type: Others
Protein ID: WP_000415748.1
Location: 377325..377720 (396 bp)
Type: Others
Protein ID: WP_000649527.1
Type: Others
Protein ID: WP_000649527.1
Location: 377871..378401 (531 bp)
Type: Others
Protein ID: WP_000415563.1
Type: Others
Protein ID: WP_000415563.1
Location: 378539..379039 (501 bp)
Type: Others
Protein ID: WP_000789723.1
Type: Others
Protein ID: WP_000789723.1
Location: 379195..379593 (399 bp)
Type: Others
Protein ID: WP_001882293.1
Type: Others
Protein ID: WP_001882293.1
Location: 374668..374958 (291 bp)
Type: Toxin
Protein ID: WP_000221352.1
Type: Toxin
Protein ID: WP_000221352.1
Location: 374948..375196 (249 bp)
Type: Antitoxin
Protein ID: WP_000213183.1
Type: Antitoxin
Protein ID: WP_000213183.1
Location: 379693..380157 (465 bp)
Type: Others
Protein ID: WP_000140244.1
Type: Others
Protein ID: WP_000140244.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF75_RS15745 | 369938..370048 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
GTF75_RS15750 | 370225..370350 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
GTF75_RS15755 | 370366..370404 | + | 39 | WP_106019119.1 | hypothetical protein | - |
GTF75_RS15760 | 370617..371621 | + | 1005 | WP_000964925.1 | LD-carboxypeptidase | - |
GTF75_RS15765 | 371774..372220 | + | 447 | WP_000128977.1 | hypothetical protein | - |
GTF75_RS15770 | 372340..373269 | + | 930 | WP_000335802.1 | hypothetical protein | - |
GTF75_RS15775 | 373266..373376 | + | 111 | WP_071917832.1 | DUF3265 domain-containing protein | - |
GTF75_RS15780 | 373404..373880 | + | 477 | WP_001047180.1 | GNAT family N-acetyltransferase | - |
GTF75_RS15785 | 374017..374532 | + | 516 | WP_001201528.1 | lipocalin family protein | - |
GTF75_RS15790 | 374668..374958 | - | 291 | WP_000221352.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF75_RS15795 | 374948..375196 | - | 249 | WP_000213183.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GTF75_RS15800 | 375767..376420 | + | 654 | WP_000036957.1 | site-specific DNA-methyltransferase | - |
GTF75_RS15805 | 376692..377117 | + | 426 | WP_000415748.1 | hypothetical protein | - |
GTF75_RS15810 | 377325..377720 | + | 396 | WP_000649527.1 | DUF3465 domain-containing protein | - |
GTF75_RS15815 | 377871..378401 | + | 531 | WP_000415563.1 | hypothetical protein | - |
GTF75_RS15820 | 378539..379039 | + | 501 | WP_000789723.1 | hypothetical protein | - |
GTF75_RS15825 | 379195..379593 | + | 399 | WP_001882293.1 | hypothetical protein | - |
GTF75_RS15830 | 379693..380157 | - | 465 | WP_000140244.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 305935..411136 | 105201 | |
inside | Integron | - | - | 311015..410760 | 99745 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11247.23 Da Isoelectric Point: 10.4678
>T145872 WP_000221352.1 NZ_CP047302:c374958-374668 [Vibrio cholerae O1 biovar El Tor]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD
Download Length: 291 bp
>T145872 NZ_CP062705:2694910-2695065 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 83 a.a. Molecular weight: 8937.28 Da Isoelectric Point: 4.1079
>AT145872 WP_000213183.1 NZ_CP047302:c375196-374948 [Vibrio cholerae O1 biovar El Tor]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL
Download Length: 249 bp
>AT145872 NZ_CP062705:c2694898-2694840 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | H9L4R3 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366A3W8 |