Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 442737..443370 | Replicon | chromosome |
Accession | NZ_CP013306 | ||
Organism | Vibrio cholerae strain CRC1106 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | ASZ81_RS16920 | Protein ID | WP_000843587.1 |
Coordinates | 442737..443069 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ASZ81_RS16925 | Protein ID | WP_000071008.1 |
Coordinates | 443056..443370 (+) | Length | 105 a.a. |
Genomic Context
Location: 438178..438381 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 438662..438835 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 439195..439464 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 439782..439953 (172 bp)
Type: Others
Protein ID: Protein_481
Type: Others
Protein ID: Protein_481
Location: 440162..440548 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 440750..440992 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 441163..441540 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 441597..441711 (115 bp)
Type: Others
Protein ID: Protein_485
Type: Others
Protein ID: Protein_485
Location: 441660..441941 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 442107..442220 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 442169..442396 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 442737..443069 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 443056..443370 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 443507..443941 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 444109..444264 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 445437..445743 (307 bp)
Type: Others
Protein ID: Protein_494
Type: Others
Protein ID: Protein_494
Location: 445880..446572 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 446572..446973 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 446943..447086 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 447161..447574 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 447788..448039 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 448029..448316 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 444389..445369 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ81_RS20855 | 438178..438381 | + | 204 | WP_001911745.1 | hypothetical protein | - |
ASZ81_RS20660 | 438662..438835 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
ASZ81_RS16860 | 439195..439464 | + | 270 | WP_001198131.1 | hypothetical protein | - |
ASZ81_RS21015 | 439782..439953 | + | 172 | Protein_481 | DUF645 family protein | - |
ASZ81_RS16875 | 440162..440548 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ81_RS16880 | 440750..440992 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ81_RS16885 | 441163..441540 | + | 378 | WP_000411109.1 | hypothetical protein | - |
ASZ81_RS20980 | 441597..441711 | + | 115 | Protein_485 | acetyltransferase | - |
ASZ81_RS16890 | 441660..441941 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
ASZ81_RS16905 | 442107..442220 | + | 114 | WP_001889158.1 | hypothetical protein | - |
ASZ81_RS16910 | 442169..442396 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
ASZ81_RS16920 | 442737..443069 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ81_RS16925 | 443056..443370 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
ASZ81_RS16930 | 443507..443941 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
ASZ81_RS20760 | 444109..444264 | + | 156 | WP_000751734.1 | hypothetical protein | - |
ASZ81_RS16945 | 444389..445369 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
ASZ81_RS16950 | 445437..445743 | + | 307 | Protein_494 | CatB-related O-acetyltransferase | - |
ASZ81_RS16955 | 445880..446572 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
ASZ81_RS16960 | 446572..446973 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
ASZ81_RS20675 | 446943..447086 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
ASZ81_RS16970 | 447161..447574 | + | 414 | WP_000049417.1 | VOC family protein | - |
ASZ81_RS16975 | 447788..448039 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ81_RS16980 | 448029..448316 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304741..463550 | 158809 | |
inside | Integron | - | - | 309821..463174 | 153353 | ||
flank | IS/Tn | - | - | 444389..445369 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T58272 WP_000843587.1 NZ_CP013306:442737-443069 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T58272 NZ_CP013306:442737-443069 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT58272 WP_000071008.1 NZ_CP013306:443056-443370 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT58272 NZ_CP013306:443056-443370 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA