Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
| Location | 803208..803779 | Replicon | chromosome |
| Accession | NZ_CP102928 | ||
| Organism | Vibrio cholerae strain N1252 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | Q9KMA2 |
| Locus tag | NW313_RS17830 | Protein ID | WP_000351248.1 |
| Coordinates | 803378..803779 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | Q8GNG3 |
| Locus tag | NW313_RS17825 | Protein ID | WP_001080654.1 |
| Coordinates | 803208..803378 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW313_RS17770 | 798403..798517 | + | 115 | Protein_777 | acetyltransferase | - |
| NW313_RS17775 | 798526..798747 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
| NW313_RS17780 | 798913..799026 | + | 114 | WP_001889158.1 | hypothetical protein | - |
| NW313_RS17785 | 798975..799202 | + | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
| NW313_RS17790 | 799543..799875 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NW313_RS17795 | 799862..800176 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
| NW313_RS17800 | 800313..800747 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
| NW313_RS17805 | 800915..801070 | + | 156 | WP_000751734.1 | hypothetical protein | - |
| NW313_RS17810 | 801195..802175 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
| NW313_RS17815 | 802243..802549 | + | 307 | Protein_786 | CatB-related O-acetyltransferase | - |
| NW313_RS17820 | 802686..803084 | + | 399 | Protein_787 | GNAT family N-acetyltransferase | - |
| NW313_RS17825 | 803208..803378 | + | 171 | WP_001080654.1 | hypothetical protein | Antitoxin |
| NW313_RS17830 | 803378..803779 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NW313_RS17835 | 803782..803892 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
| NW313_RS17840 | 803967..804380 | + | 414 | WP_000049417.1 | VOC family protein | - |
| NW313_RS17845 | 804594..804845 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NW313_RS17850 | 804835..805122 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NW313_RS17855 | 805250..805705 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| NW313_RS17860 | 805762..805884 | + | 123 | Protein_795 | acetyltransferase | - |
| NW313_RS17865 | 806055..806179 | + | 125 | Protein_796 | DUF645 family protein | - |
| NW313_RS17870 | 806296..806364 | + | 69 | Protein_797 | acetyltransferase | - |
| NW313_RS17875 | 806381..806878 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| NW313_RS17880 | 806875..807147 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| NW313_RS17885 | 807299..807361 | + | 63 | Protein_800 | acetyltransferase | - |
| NW313_RS17890 | 807378..808046 | + | 669 | WP_000043871.1 | hypothetical protein | - |
| NW313_RS17895 | 808198..808485 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 713852..820357 | 106505 | |
| inside | Integron | catB9 | - | 718932..819981 | 101049 | ||
| flank | IS/Tn | - | - | 801195..802175 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T254475 WP_000351248.1 NZ_CP102928:803378-803779 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q0PN34 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1T4SJJ1 |