254475

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 803208..803779 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name doc Uniprot ID Q9KMA2
Locus tag NW313_RS17830 Protein ID WP_000351248.1
Coordinates 803378..803779 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID Q8GNG3
Locus tag NW313_RS17825 Protein ID WP_001080654.1
Coordinates 803208..803378 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17770 798403..798517 + 115 Protein_777 acetyltransferase -
NW313_RS17775 798526..798747 + 222 WP_032468461.1 DUF1289 domain-containing protein -
NW313_RS17780 798913..799026 + 114 WP_001889158.1 hypothetical protein -
NW313_RS17785 798975..799202 + 228 WP_073426587.1 DUF1289 domain-containing protein -
NW313_RS17790 799543..799875 + 333 WP_000843587.1 type II toxin-antitoxin system RelE/ParE family toxin -
NW313_RS17795 799862..800176 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
NW313_RS17800 800313..800747 + 435 WP_000256036.1 GNAT family N-acetyltransferase -
NW313_RS17805 800915..801070 + 156 WP_000751734.1 hypothetical protein -
NW313_RS17810 801195..802175 - 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
NW313_RS17815 802243..802549 + 307 Protein_786 CatB-related O-acetyltransferase -
NW313_RS17820 802686..803084 + 399 Protein_787 GNAT family N-acetyltransferase -
NW313_RS17825 803208..803378 + 171 WP_001080654.1 hypothetical protein Antitoxin
NW313_RS17830 803378..803779 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NW313_RS17835 803782..803892 + 111 WP_082798255.1 DUF3265 domain-containing protein -
NW313_RS17840 803967..804380 + 414 WP_000049417.1 VOC family protein -
NW313_RS17845 804594..804845 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NW313_RS17850 804835..805122 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
NW313_RS17855 805250..805705 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
NW313_RS17860 805762..805884 + 123 Protein_795 acetyltransferase -
NW313_RS17865 806055..806179 + 125 Protein_796 DUF645 family protein -
NW313_RS17870 806296..806364 + 69 Protein_797 acetyltransferase -
NW313_RS17875 806381..806878 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
NW313_RS17880 806875..807147 - 273 WP_000246253.1 DUF1778 domain-containing protein -
NW313_RS17885 807299..807361 + 63 Protein_800 acetyltransferase -
NW313_RS17890 807378..808046 + 669 WP_000043871.1 hypothetical protein -
NW313_RS17895 808198..808485 + 288 WP_000426470.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049
flank IS/Tn - - 801195..802175 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-132)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14608.71 Da        Isoelectric Point: 4.0128

>T254475 WP_000351248.1 NZ_CP102928:803378-803779 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Download         Length: 402 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6287.35 Da        Isoelectric Point: 10.7274

>AT254475 WP_001080654.1 NZ_CP102928:803208-803378 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0PN34

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SJJ1

References