Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
Location | 803208..803779 | Replicon | chromosome |
Accession | NZ_CP102928 | ||
Organism | Vibrio cholerae strain N1252 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | NW313_RS17830 | Protein ID | WP_000351248.1 |
Coordinates | 803378..803779 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | Q8GNG3 |
Locus tag | NW313_RS17825 | Protein ID | WP_001080654.1 |
Coordinates | 803208..803378 (+) | Length | 57 a.a. |
Genomic Context
Location: 798403..798517 (115 bp)
Type: Others
Protein ID: Protein_777
Type: Others
Protein ID: Protein_777
Location: 798526..798747 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 798913..799026 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 798975..799202 (228 bp)
Type: Others
Protein ID: WP_073426587.1
Type: Others
Protein ID: WP_073426587.1
Location: 799543..799875 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 799862..800176 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 800313..800747 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 800915..801070 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 802243..802549 (307 bp)
Type: Others
Protein ID: Protein_786
Type: Others
Protein ID: Protein_786
Location: 802686..803084 (399 bp)
Type: Others
Protein ID: Protein_787
Type: Others
Protein ID: Protein_787
Location: 803208..803378 (171 bp)
Type: Antitoxin
Protein ID: WP_001080654.1
Type: Antitoxin
Protein ID: WP_001080654.1
Location: 803378..803779 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 803782..803892 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 803967..804380 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 804594..804845 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 804835..805122 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 805250..805705 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 805762..805884 (123 bp)
Type: Others
Protein ID: Protein_795
Type: Others
Protein ID: Protein_795
Location: 806055..806179 (125 bp)
Type: Others
Protein ID: Protein_796
Type: Others
Protein ID: Protein_796
Location: 806296..806364 (69 bp)
Type: Others
Protein ID: Protein_797
Type: Others
Protein ID: Protein_797
Location: 807299..807361 (63 bp)
Type: Others
Protein ID: Protein_800
Type: Others
Protein ID: Protein_800
Location: 807378..808046 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 808198..808485 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 801195..802175 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 806381..806878 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 806875..807147 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW313_RS17770 | 798403..798517 | + | 115 | Protein_777 | acetyltransferase | - |
NW313_RS17775 | 798526..798747 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
NW313_RS17780 | 798913..799026 | + | 114 | WP_001889158.1 | hypothetical protein | - |
NW313_RS17785 | 798975..799202 | + | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
NW313_RS17790 | 799543..799875 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NW313_RS17795 | 799862..800176 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
NW313_RS17800 | 800313..800747 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
NW313_RS17805 | 800915..801070 | + | 156 | WP_000751734.1 | hypothetical protein | - |
NW313_RS17810 | 801195..802175 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
NW313_RS17815 | 802243..802549 | + | 307 | Protein_786 | CatB-related O-acetyltransferase | - |
NW313_RS17820 | 802686..803084 | + | 399 | Protein_787 | GNAT family N-acetyltransferase | - |
NW313_RS17825 | 803208..803378 | + | 171 | WP_001080654.1 | hypothetical protein | Antitoxin |
NW313_RS17830 | 803378..803779 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NW313_RS17835 | 803782..803892 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
NW313_RS17840 | 803967..804380 | + | 414 | WP_000049417.1 | VOC family protein | - |
NW313_RS17845 | 804594..804845 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NW313_RS17850 | 804835..805122 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NW313_RS17855 | 805250..805705 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
NW313_RS17860 | 805762..805884 | + | 123 | Protein_795 | acetyltransferase | - |
NW313_RS17865 | 806055..806179 | + | 125 | Protein_796 | DUF645 family protein | - |
NW313_RS17870 | 806296..806364 | + | 69 | Protein_797 | acetyltransferase | - |
NW313_RS17875 | 806381..806878 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
NW313_RS17880 | 806875..807147 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
NW313_RS17885 | 807299..807361 | + | 63 | Protein_800 | acetyltransferase | - |
NW313_RS17890 | 807378..808046 | + | 669 | WP_000043871.1 | hypothetical protein | - |
NW313_RS17895 | 808198..808485 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 713852..820357 | 106505 | |
inside | Integron | catB9 | - | 718932..819981 | 101049 | ||
flank | IS/Tn | - | - | 801195..802175 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T254475 WP_000351248.1 NZ_CP102928:803378-803779 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SJJ1 |