Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 367479..367977 | Replicon | chromosome |
Accession | NZ_CP013314 | ||
Organism | Vibrio cholerae strain E9120 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | ASZ79_RS16055 | Protein ID | WP_000589156.1 |
Coordinates | 367479..367745 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | ASZ79_RS16060 | Protein ID | WP_000643598.1 |
Coordinates | 367732..367977 (+) | Length | 82 a.a. |
Genomic Context
Location: 362900..363106 (207 bp)
Type: Others
Protein ID: Protein_347
Type: Others
Protein ID: Protein_347
Location: 363306..363407 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 363397..363783 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 363978..364229 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 364202..364351 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 364443..364685 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 364937..365215 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 365590..365733 (144 bp)
Type: Others
Protein ID: Protein_354
Type: Others
Protein ID: Protein_354
Location: 365787..365825 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 366037..366504 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 366632..367294 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 367479..367745 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 367732..367977 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 368073..368867 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 368970..369098 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 369159..369341 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 369557..370561 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 370714..371073 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 371346..371579 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 371847..372353 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 372510..372896 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ79_RS20575 | 362900..363106 | + | 207 | Protein_347 | DUF3709 domain-containing protein | - |
ASZ79_RS20580 | 363306..363407 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ79_RS16010 | 363397..363783 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ79_RS16015 | 363978..364229 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ79_RS16020 | 364202..364351 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ79_RS16025 | 364443..364685 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ79_RS16030 | 364937..365215 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
ASZ79_RS20990 | 365590..365733 | + | 144 | Protein_354 | DUF645 family protein | - |
ASZ79_RS20995 | 365787..365825 | + | 39 | WP_082798268.1 | hypothetical protein | - |
ASZ79_RS16045 | 366037..366504 | + | 468 | WP_001289288.1 | OsmC family protein | - |
ASZ79_RS16050 | 366632..367294 | + | 663 | WP_000960654.1 | hypothetical protein | - |
ASZ79_RS16055 | 367479..367745 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
ASZ79_RS16060 | 367732..367977 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
ASZ79_RS16065 | 368073..368867 | + | 795 | WP_001911581.1 | hypothetical protein | - |
ASZ79_RS21000 | 368970..369098 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
ASZ79_RS16080 | 369159..369341 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
ASZ79_RS16085 | 369557..370561 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
ASZ79_RS16090 | 370714..371073 | + | 360 | WP_001071541.1 | VOC family protein | - |
ASZ79_RS16095 | 371346..371579 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
ASZ79_RS16100 | 371847..372353 | + | 507 | WP_000393074.1 | hypothetical protein | - |
ASZ79_RS16105 | 372510..372896 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..468464 | 163764 | |
inside | Integron | - | - | 309780..468088 | 158308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T58356 WP_000589156.1 NZ_CP013314:367479-367745 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T58356 NZ_CP013314:367479-367745 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT58356 WP_000643598.1 NZ_CP013314:367732-367977 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT58356 NZ_CP013314:367732-367977 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |