Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 328014..328554 | Replicon | chromosome |
Accession | NZ_LT906615 | ||
Organism | Vibrio cholerae O1 biovar El Tor str. N16961 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | FY484_RS15415 | Protein ID | WP_000277238.1 |
Coordinates | 328014..328283 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | FY484_RS15420 | Protein ID | WP_001258569.1 |
Coordinates | 328276..328554 (-) | Length | 93 a.a. |
Genomic Context
Location: 323504..323890 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 323947..324060 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 324009..324290 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 324548..325084 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 325221..325736 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 327045..327170 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 327186..327224 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 327420..327866 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 328840..329118 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 329370..329576 (207 bp)
Type: Others
Protein ID: Protein_292
Type: Others
Protein ID: Protein_292
Location: 329776..329877 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 329867..330253 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 330448..330699 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 330672..330821 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 330913..331155 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 331407..331685 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 332060..332203 (144 bp)
Type: Others
Protein ID: Protein_299
Type: Others
Protein ID: Protein_299
Location: 332257..332295 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 332507..332974 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 323018..323260 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 325886..326383 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 326380..326652 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 328014..328283 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 328276..328554 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FY484_RS15345 | 323018..323260 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FY484_RS15350 | 323504..323890 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
FY484_RS15355 | 323947..324060 | + | 114 | WP_001900214.1 | hypothetical protein | - |
FY484_RS15360 | 324009..324290 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
FY484_RS15375 | 324548..325084 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
FY484_RS15380 | 325221..325736 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
FY484_RS15385 | 325886..326383 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
FY484_RS15390 | 326380..326652 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
FY484_RS15395 | 327045..327170 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
FY484_RS15400 | 327186..327224 | + | 39 | WP_106019118.1 | hypothetical protein | - |
FY484_RS15410 | 327420..327866 | + | 447 | WP_000006157.1 | hypothetical protein | - |
FY484_RS15415 | 328014..328283 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FY484_RS15420 | 328276..328554 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FY484_RS15430 | 328840..329118 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
FY484_RS15435 | 329370..329576 | + | 207 | Protein_292 | DUF3709 domain-containing protein | - |
FY484_RS15440 | 329776..329877 | + | 102 | WP_001921603.1 | hypothetical protein | - |
FY484_RS15445 | 329867..330253 | + | 387 | WP_000703163.1 | VOC family protein | - |
FY484_RS15450 | 330448..330699 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
FY484_RS15455 | 330672..330821 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
FY484_RS15460 | 330913..331155 | + | 243 | WP_000107461.1 | hypothetical protein | - |
FY484_RS15465 | 331407..331685 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
FY484_RS19505 | 332060..332203 | + | 144 | Protein_299 | DUF645 family protein | - |
FY484_RS19510 | 332257..332295 | + | 39 | WP_082798268.1 | hypothetical protein | - |
FY484_RS15480 | 332507..332974 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T293794 WP_000277238.1 NZ_LT906615:c328283-328014 [Vibrio cholerae O1 biovar El Tor str. N16961]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |