Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 328014..328554 | Replicon | chromosome |
| Accession | NZ_LT906615 | ||
| Organism | Vibrio cholerae O1 biovar El Tor str. N16961 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A151JGK8 |
| Locus tag | FY484_RS15415 | Protein ID | WP_000277238.1 |
| Coordinates | 328014..328283 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KML3 |
| Locus tag | FY484_RS15420 | Protein ID | WP_001258569.1 |
| Coordinates | 328276..328554 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FY484_RS15345 | 323018..323260 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| FY484_RS15350 | 323504..323890 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
| FY484_RS15355 | 323947..324060 | + | 114 | WP_001900214.1 | hypothetical protein | - |
| FY484_RS15360 | 324009..324290 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
| FY484_RS15375 | 324548..325084 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
| FY484_RS15380 | 325221..325736 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
| FY484_RS15385 | 325886..326383 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| FY484_RS15390 | 326380..326652 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| FY484_RS15395 | 327045..327170 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
| FY484_RS15400 | 327186..327224 | + | 39 | WP_106019118.1 | hypothetical protein | - |
| FY484_RS15410 | 327420..327866 | + | 447 | WP_000006157.1 | hypothetical protein | - |
| FY484_RS15415 | 328014..328283 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| FY484_RS15420 | 328276..328554 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FY484_RS15430 | 328840..329118 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
| FY484_RS15435 | 329370..329576 | + | 207 | Protein_292 | DUF3709 domain-containing protein | - |
| FY484_RS15440 | 329776..329877 | + | 102 | WP_001921603.1 | hypothetical protein | - |
| FY484_RS15445 | 329867..330253 | + | 387 | WP_000703163.1 | VOC family protein | - |
| FY484_RS15450 | 330448..330699 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
| FY484_RS15455 | 330672..330821 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
| FY484_RS15460 | 330913..331155 | + | 243 | WP_000107461.1 | hypothetical protein | - |
| FY484_RS15465 | 331407..331685 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
| FY484_RS19505 | 332060..332203 | + | 144 | Protein_299 | DUF645 family protein | - |
| FY484_RS19510 | 332257..332295 | + | 39 | WP_082798268.1 | hypothetical protein | - |
| FY484_RS15480 | 332507..332974 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
| inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T293794 WP_000277238.1 NZ_LT906615:c328283-328014 [Vibrio cholerae O1 biovar El Tor str. N16961]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A151JGK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A151KTP9 |