Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 912760..913288 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag DG247_RS18480 Protein ID WP_000221354.1
Coordinates 912760..913047 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0X1KZS8
Locus tag DG247_RS18485 Protein ID WP_001250179.1
Coordinates 913037..913288 (-) Length 84 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS18430 907863..908396 - 534 WP_000118351.1 GNAT family N-acetyltransferase -
DG247_RS18435 908393..908818 - 426 WP_001882332.1 DUF1778 domain-containing protein -
DG247_RS18440 908885..909256 - 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG247_RS18445 909397..909684 - 288 WP_000426470.1 hypothetical protein -
DG247_RS18450 909836..910504 - 669 WP_000043871.1 hypothetical protein -
DG247_RS18455 910735..911007 + 273 WP_000246253.1 DUF1778 domain-containing protein -
DG247_RS18460 911004..911501 + 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG247_RS18470 911703..911855 - 153 WP_001884520.1 DUF645 family protein -
DG247_RS18475 912177..912632 - 456 WP_001245327.1 GNAT family N-acetyltransferase -
DG247_RS18480 912760..913047 - 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG247_RS18485 913037..913288 - 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG247_RS18490 913502..913915 - 414 WP_000049417.1 VOC family protein -
DG247_RS18495 913990..914133 - 144 WP_071908341.1 DUF3265 domain-containing protein -
DG247_RS18500 914103..914504 - 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
DG247_RS18505 914504..915196 - 693 WP_001047169.1 GNAT family N-acetyltransferase -
DG247_RS18510 915333..915639 - 307 Protein_787 CatB-related O-acetyltransferase -
DG247_RS18515 915707..916687 + 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
DG247_RS19670 916812..916967 - 156 WP_000751734.1 hypothetical protein -
DG247_RS18520 917135..917569 - 435 WP_000256036.1 GNAT family N-acetyltransferase -
DG247_RS18525 917706..918020 - 315 WP_000071008.1 DNA-binding transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808
flank IS/Tn - - 915707..916687 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T294354 WP_000221354.1 NZ_LT992487:c913047-912760 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp


Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.29 Da        Isoelectric Point: 4.0197

>AT294354 WP_001250179.1 NZ_LT992487:c913288-913037 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6


Antitoxin

Source ID Structure
AlphaFold DB A0A0X1KZS8

References