Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 394802..395340 | Replicon | chromosome |
Accession | NZ_OW443148 | ||
Organism | Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | OC617_RS15785 | Protein ID | WP_000802136.1 |
Coordinates | 394802..395101 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | OC617_RS15790 | Protein ID | WP_001107719.1 |
Coordinates | 395098..395340 (-) | Length | 81 a.a. |
Genomic Context
Location: 390539..390676 (138 bp)
Type: Others
Protein ID: WP_001890145.1
Type: Others
Protein ID: WP_001890145.1
Location: 390737..390919 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 391119..391592 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 391607..391699 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 391741..392367 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 392490..393188 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 393219..393308 (90 bp)
Type: Others
Protein ID: WP_072606010.1
Type: Others
Protein ID: WP_072606010.1
Location: 393886..394065 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 394279..394674 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 395569..396147 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 396169..396261 (93 bp)
Type: Others
Protein ID: WP_014164112.1
Type: Others
Protein ID: WP_014164112.1
Location: 396685..397368 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 397582..397848 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 398003..398602 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 398883..399818 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 399784..399924 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 394802..395101 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 395098..395340 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OC617_RS15740 | 390539..390676 | + | 138 | WP_001890145.1 | hypothetical protein | - |
OC617_RS15745 | 390737..390919 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
OC617_RS15750 (CNRVC190243H_03115) | 391119..391592 | + | 474 | WP_001161076.1 | GrpB family protein | - |
OC617_RS15755 | 391607..391699 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
OC617_RS15760 (CNRVC190243H_03116) | 391741..392367 | + | 627 | WP_000365424.1 | LysE family translocator | - |
OC617_RS15765 (CNRVC190243H_03117) | 392490..393188 | + | 699 | WP_001890502.1 | hypothetical protein | - |
OC617_RS15770 | 393219..393308 | + | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
OC617_RS15775 | 393886..394065 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
OC617_RS15780 (CNRVC190243H_03119) | 394279..394674 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
OC617_RS15785 (CNRVC190243H_03120) | 394802..395101 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OC617_RS15790 (CNRVC190243H_03121) | 395098..395340 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
OC617_RS15795 (CNRVC190243H_03122) | 395569..396147 | + | 579 | WP_000110120.1 | hypothetical protein | - |
OC617_RS15800 | 396169..396261 | + | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
OC617_RS15805 (CNRVC190243H_03124) | 396685..397368 | + | 684 | WP_000877436.1 | hypothetical protein | - |
OC617_RS15810 (CNRVC190243H_03125) | 397582..397848 | + | 267 | WP_000937852.1 | hypothetical protein | - |
OC617_RS15815 (CNRVC190243H_03126) | 398003..398602 | + | 600 | WP_000429495.1 | DUF6338 family protein | - |
OC617_RS15820 (CNRVC190243H_03127) | 398883..399818 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
OC617_RS15825 | 399784..399924 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 349905..456410 | 106505 | |
inside | Integron | catB9 | - | 354985..456034 | 101049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T295391 WP_000802136.1 NZ_OW443148:c395101-394802 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |