Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 328886..329426 | Replicon | chromosome |
Accession | NZ_CP072848 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | J9265_RS15215 | Protein ID | WP_000277238.1 |
Coordinates | 328886..329155 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | J9265_RS15220 | Protein ID | WP_001258569.1 |
Coordinates | 329148..329426 (-) | Length | 93 a.a. |
Genomic Context
Location: 324376..324762 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 324819..324932 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 324941..325162 (222 bp)
Type: Others
Protein ID: WP_032467793.1
Type: Others
Protein ID: WP_032467793.1
Location: 325420..325956 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 326147..326608 (462 bp)
Type: Others
Protein ID: WP_001903091.1
Type: Others
Protein ID: WP_001903091.1
Location: 326673..326741 (69 bp)
Type: Others
Protein ID: Protein_286
Type: Others
Protein ID: Protein_286
Location: 327917..328042 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 328292..328738 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 329477..329594 (118 bp)
Type: Others
Protein ID: Protein_293
Type: Others
Protein ID: Protein_293
Location: 329712..329990 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 330350..330448 (99 bp)
Type: Others
Protein ID: WP_223225486.1
Type: Others
Protein ID: WP_223225486.1
Location: 330648..330749 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 330739..331125 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 331320..331571 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 331544..331693 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 331785..332027 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 332279..332557 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 332989..333032 (44 bp)
Type: Others
Protein ID: Protein_302
Type: Others
Protein ID: Protein_302
Location: 333014..333107 (94 bp)
Type: Others
Protein ID: Protein_303
Type: Others
Protein ID: Protein_303
Location: 333076..333207 (132 bp)
Type: Others
Protein ID: WP_001883067.1
Type: Others
Protein ID: WP_001883067.1
Location: 333379..333846 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 323890..324132 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 326758..327255 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 327252..327524 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 328886..329155 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 329148..329426 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J9265_RS15160 (J9265_15160) | 323890..324132 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
J9265_RS15165 (J9265_15165) | 324376..324762 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
J9265_RS15170 (J9265_15170) | 324819..324932 | + | 114 | WP_001900214.1 | hypothetical protein | - |
J9265_RS15175 (J9265_15175) | 324941..325162 | + | 222 | WP_032467793.1 | DUF1289 domain-containing protein | - |
J9265_RS15180 (J9265_15180) | 325420..325956 | + | 537 | WP_000469482.1 | GNAT family protein | - |
J9265_RS15185 (J9265_15185) | 326147..326608 | + | 462 | WP_001903091.1 | lipocalin family protein | - |
J9265_RS19000 | 326673..326741 | + | 69 | Protein_286 | acetyltransferase | - |
J9265_RS15190 (J9265_15190) | 326758..327255 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
J9265_RS15195 (J9265_15195) | 327252..327524 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
J9265_RS15200 (J9265_15200) | 327917..328042 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
J9265_RS15210 (J9265_15210) | 328292..328738 | + | 447 | WP_000006157.1 | hypothetical protein | - |
J9265_RS15215 (J9265_15215) | 328886..329155 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
J9265_RS15220 (J9265_15220) | 329148..329426 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
J9265_RS19005 | 329477..329594 | + | 118 | Protein_293 | DUF3265 domain-containing protein | - |
J9265_RS15225 (J9265_15225) | 329712..329990 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
J9265_RS19010 | 330350..330448 | + | 99 | WP_223225486.1 | DUF3709 domain-containing protein | - |
J9265_RS15235 (J9265_15235) | 330648..330749 | + | 102 | WP_001921603.1 | hypothetical protein | - |
J9265_RS15240 (J9265_15240) | 330739..331125 | + | 387 | WP_000703163.1 | VOC family protein | - |
J9265_RS15245 (J9265_15245) | 331320..331571 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
J9265_RS15250 (J9265_15250) | 331544..331693 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
J9265_RS15255 (J9265_15255) | 331785..332027 | + | 243 | WP_000107461.1 | hypothetical protein | - |
J9265_RS15260 (J9265_15260) | 332279..332557 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
J9265_RS19015 | 332989..333032 | + | 44 | Protein_302 | hypothetical protein | - |
J9265_RS19020 | 333014..333107 | + | 94 | Protein_303 | ggdef family protein | - |
J9265_RS19025 | 333076..333207 | + | 132 | WP_001883067.1 | hypothetical protein | - |
J9265_RS15275 (J9265_15275) | 333379..333846 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306914..436175 | 129261 | |
inside | Integron | - | - | 311994..435799 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T198980 WP_000277238.1 NZ_CP072848:c329155-328886 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T198980 NZ_CP072848:c329155-328886 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT198980 WP_001258569.1 NZ_CP072848:c329426-329148 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT198980 NZ_CP072848:c329426-329148 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |